DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and ZC250.2

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_504520.2 Gene:ZC250.2 WormBaseID:WBGene00022576 Length:449 Species:Caenorhabditis elegans

Alignment Length:239 Identity:48/240 (20%)
Similarity:89/240 (37%) Gaps:62/240 (26%)


  Fly    15 VKRTWGKHCNVLLFVSGDIDGELEPYVPVIN----STD------TWTLVQQGLMQAYLFYADQID 69
            :|.||....:.:.:.|   |.| :|.:|.||    :||      ||.:.::.|..:    .:...
 Worm   245 LKNTWASDVSRIEYCS---DKE-DPAIPTINLGVDNTDRGHCAKTWEIFRRFLGSS----GNGAK 301

  Fly    70 WFLRVEPSSFVVLENLRYMIHKRKYQPSQPIY------FGYELENIVTHESFVHHHSGYVISREA 128
            |.:..:..:.:..:.|:.|:  ..|.....|.      :|:.|.....:: :....||.:.:|.|
 Worm   302 WLVVADDDTLMNFKRLKQML--ELYDSGDKIIIGERYGYGFSLNGDSGYD-YPTGGSGMIFTRSA 363

  Fly   129 LRRY------TMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQ 187
            :...      .:|:.||::            :.|..|...|.:.:.       ||:.|.......
 Worm   364 VESLLAQCPSCIANTDPDD------------MTIGICALTAGIPIV-------HESRLHQARPLD 409

  Fly   188 FLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDY 231
            :...|...|    :|:||.|: ..|||     ...||..|:.:|
 Worm   410 YAPEYIKYP----ISFHKFTD-IDPIS-----VYYEYLVELEEY 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
ZC250.2NP_504520.2 Galactosyl_T 231..424 CDD:304462 40/213 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.