DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and B3GLCT

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT HGNCID:20207 Length:498 Species:Homo sapiens

Alignment Length:208 Identity:45/209 (22%)
Similarity:93/209 (44%) Gaps:37/209 (18%)


  Fly    10 DTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPV-INSTD------TWTLVQQGLMQAYLFYADQ 67
            |....||:||....:::.:.|...:..: |.|.: |.:||      |:.::::.|.::    .|:
Human   282 DRIPIVKQTWESQASLIEYYSDYTENSI-PTVDLGIPNTDRGHCGKTFAILERFLNRS----QDK 341

  Fly    68 IDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIY----FGYELENIVTHESFVHHHSGYVISREA 128
            ..|.:.|:..:.:.:..|::::  ..|...:|::    :||.|.  ....|::....|.|.||||
Human   342 TAWLVIVDDDTLISISRLQHLL--SCYDSGEPVFLGERYGYGLG--TGGYSYITGGGGMVFSREA 402

  Fly   129 LRRYTMASKDPENKECTHWEGYV-EGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGY 192
            :|| .:|||      |..:.... :.:.:..|  |:.:.:..:.....|:. .||.....:|:  
Human   403 VRR-LLASK------CRCYSNDAPDDMVLGMC--FSGLGIPVTHSPLFHQA-RPVDYPKDYLS-- 455

  Fly   193 DTIPWLRKLSYHK 205
            ..:|    :|:||
Human   456 HQVP----ISFHK 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 45/209 (22%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.