DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and B3GLCT

DIOPT Version :10

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT / 145173 HGNCID:20207 Length:498 Species:Homo sapiens


Alignment Length:254 Identity:52/254 - (20%)
Similarity:109/254 - (42%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLILTLYINVSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNYNSPDTAKYVKRTWGKHCNVLLF 82
            |...|.:.:...:.|||.|:          ::|.:.......::. |....||:||....:::.:
Human   247 FYCATTFHSFLPLCRKPVKK----------KDIFVAVKTCKKFHG-DRIPIVKQTWESQASLIEY 300

  Fly    83 VSGDIDGELEPYVPV-INSTD------TWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLR 140
            .|...:..: |.|.: |.:||      |:.::::.|.::    .|:..|.:.|:..:.:.:..|:
Human   301 YSDYTENSI-PTVDLGIPNTDRGHCGKTFAILERFLNRS----QDKTAWLVIVDDDTLISISRLQ 360

  Fly   141 YMIHKRKYQPSQPIY----FGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHW 201
            :::  ..|...:|::    :||.|.  ....|::....|.|.||||:|| .:|||      |..:
Human   361 HLL--SCYDSGEPVFLGERYGYGLG--TGGYSYITGGGGMVFSREAVRR-LLASK------CRCY 414

  Fly   202 EGYV-EGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHK 259
            .... :.:.:..|  |:.:.:..:.....|:. .||.....:|:  ..:|    :|:||
Human   415 SNDAPDDMVLGMC--FSGLGIPVTHSPLFHQA-RPVDYPKDYLS--HQVP----ISFHK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
B3GLCTNP_919299.3 Fringe 264..467 CDD:367085 47/237 (20%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.