DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC100496837

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002933733.2 Gene:LOC100496837 XenbaseID:XB-GENE-5871034 Length:279 Species:Xenopus tropicalis

Alignment Length:250 Identity:77/250 (31%)
Similarity:117/250 (47%) Gaps:31/250 (12%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI-----NSTDT--WTLVQQGLMQAYLFY 64
            |....|.:||.||.:||||.||:|...|.|.    |.|     ...|.  |..: :....|:.:|
 Frog     6 NLQTKAIHVKNTWTRHCNVALFMSSVTDKEF----PTIGLGTGEGRDKLYWKTI-RAFHYAHKYY 65

  Fly    65 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREAL 129
            .::.|||.:.:..:||:|||:|:|:  ..|...||||||...:..: .:.::...:|||:|||||
 Frog    66 LNETDWFFKGDDDTFVILENMRWML--SNYTADQPIYFGKRFKPYI-KQGYMSGGAGYVLSREAL 127

  Fly   130 RRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDT 194
            .|:....:   ...|||... .|.:.|..|::...|...:|||..:.|||.|.:.:     |:.|
 Frog   128 IRFVEGFR---TGICTHTTS-TEDVAIGNCMQLMGVIAGDSRDTEKRETFHPFSPE-----GHIT 183

  Fly   195 IPWLRKLSYHKRTEKTVPI-------SSRAICFLVEYPPEMYDYYYFVYRLKIFG 242
            :.::...|:...:....||       |..||.|....|..||...|..|.|:.:|
 Frog   184 MKFVDSKSFWYWSYCVYPIVEGPQCCSDLAISFHYISPEHMYTLEYLTYHLRAYG 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
LOC100496837XP_002933733.2 Galactosyl_T 9..>159 CDD:304462 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.