DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and c1galt1

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002938761.1 Gene:c1galt1 XenbaseID:XB-GENE-992000 Length:362 Species:Xenopus tropicalis

Alignment Length:255 Identity:75/256 (29%)
Similarity:128/256 (50%) Gaps:26/256 (10%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDT--------WTLVQQGLMQAYLF 63
            |.....|:||.||.:.||.:|::|.:.:.|.    |.: ..||        |..: :.....:..
 Frog   103 NLDKKTKHVKATWAQRCNKVLYMSSEENKEF----PTV-GLDTKEGRDQLYWKTI-KAFQYVHDH 161

  Fly    64 YADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREA 128
            :.::.|||::.:..::|||:|||:::  .|:.|:.|:|||...:..| .:.::...:|||:|:||
 Frog   162 HLEEADWFMKADDDTYVVLDNLRWLL--SKHDPNDPVYFGRRFKPYV-KQGYMSGGAGYVLSKEA 223

  Fly   129 LRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYD 193
            |:|:..|.|:   ::||| ...||.|.:.:|:...||...:|||....|||.|...::..::|| 
 Frog   224 LKRFVNAFKE---EKCTH-SSSVEDLALGKCMENINVKAGDSRDTSGKETFHPFVPEHHLIHGY- 283

  Fly   194 TIP---WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSID 250
             :|   |....:|:...|.....|..|:.|.......||...|.|:.|:.:|...|.|.|
 Frog   284 -LPKTFWYWNYNYYPAVEGPGCCSDLAVSFHYVDSTTMYQLEYLVHHLRPYGYKHRYSPD 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
c1galt1XP_002938761.1 Galactosyl_T <168..>254 CDD:304462 32/93 (34%)
EEP 280..>361 CDD:294334 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C88712678
eggNOG 1 0.900 E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.800

Return to query results.
Submit another query.