DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC100486323

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017947371.1 Gene:LOC100486323 ID: Length:254 Species:Xenopus tropicalis

Alignment Length:262 Identity:87/263 (33%)
Similarity:130/263 (49%) Gaps:43/263 (16%)


  Fly     3 PYNYNSPDTAKYVKRTWGKHCNVLLFVS------------GDIDGELEPYVPVINSTDTWTLVQ- 54
            |.|..|  .|.::||:|.:|||:.||:|            |..:|..|.|         |..:: 
 Frog     4 PNNLQS--KAIHLKRSWTRHCNITLFMSSTANETFPTIGLGTKEGREELY---------WKTIRA 57

  Fly    55 -QGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHH 118
             |.:.|.||   ||.||||:.:..:|||:|||::::  ..|.|.||||.|...:..| ::.::..
 Frog    58 FQYIHQNYL---DQADWFLKADDDTFVVMENLQFLL--SNYTPEQPIYLGKRFKPFV-NQGYMSG 116

  Fly   119 HSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVT 183
            .:|||:|:|:|:|:..|.:   ...|||... :|.|.:.:|:....|...:|||..:.|||.|.|
 Frog   117 GAGYVLSKESLKRFVEAFR---TGVCTHTSS-IEDLALGQCMEKLGVIPGDSRDSEKRETFHPFT 177

  Fly   184 MDYQFLNGY--DTIPWLRKLSYHKRTEKTVPISSRAICFLVEY-PPE-MYDYYYFVYRLKIFGTP 244
            .:...:..|  |:|.|  ...|:...:.....|..||.|  .| ||| ||...||||.|:.:|..
 Frog   178 PETHIITRYTADSIYW--GYCYYPLIQGPQCCSDLAISF--HYVPPELMYTLEYFVYHLRAYGYQ 238

  Fly   245 VR 246
            .|
 Frog   239 YR 240



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.