DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC100486174

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002933748.2 Gene:LOC100486174 ID: Length:335 Species:Xenopus tropicalis

Alignment Length:263 Identity:84/264 (32%)
Similarity:127/264 (48%) Gaps:48/264 (18%)


  Fly     8 SPDTAK----YVKRTWGKHCNVLLFVS------------GDIDGELEPYVPVINSTDTWTLVQ-- 54
            ||...|    ::||:|.:|||:.||:|            |..:|..|.|         |..::  
 Frog    81 SPKNLKKKAIHLKRSWARHCNITLFMSSTANEIFPTIGLGTKEGREELY---------WKTIRAF 136

  Fly    55 QGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHH 119
            |.:.|.||   ||.||||:.:..::||:|||::::  ..|.|.||||.|...:..|| :.::...
 Frog   137 QYIHQNYL---DQADWFLKADDDTYVVMENLQFLL--SNYTPEQPIYLGKRFKPFVT-QGYMSGG 195

  Fly   120 SGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLP--- 181
            :|||:|:|:|:|:..|.:   ...|||... :|.|.:.:|:....|...:|||..:.|||.|   
 Frog   196 AGYVLSKESLKRFVEAFR---TGVCTHTSS-IEDLALGQCMEKLGVIPGDSRDSEKRETFHPFTP 256

  Fly   182 ---VTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGT 243
               :|.||  :|.:|.. |  ...|:...:.....|..||.|....|..||...||||.|:.:|.
 Frog   257 ETHITSDY--INDFDDY-W--TYCYYPIIQGPQCCSDLAISFHYVSPELMYMLEYFVYYLRAYGY 316

  Fly   244 PVR 246
            ..|
 Frog   317 QYR 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
LOC100486174XP_002933748.2 Galactosyl_T 92..>237 CDD:304462 52/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.