DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC100486030

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002933747.2 Gene:LOC100486030 ID: Length:276 Species:Xenopus tropicalis

Alignment Length:268 Identity:79/269 (29%)
Similarity:115/269 (43%) Gaps:59/269 (22%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI-----NSTDT--WTLVQQGLMQAYLFY 64
            |....|.:||.||.:||||.||:|...|.|.    |.|     ...|.  |..: :....|:.:|
 Frog     6 NLQTKAIHVKNTWTRHCNVALFMSSVTDKEF----PTIGLGTGEGRDKLYWKTI-RAFHYAHKYY 65

  Fly    65 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREAL 129
            .::.||||:.:..::.:::|||:|:  ..|.|.||||||...:... .:.::...:|||:|||||
 Frog    66 LNETDWFLKADDDTYAIVDNLRWML--SNYTPDQPIYFGKRFKPFF-KQGYMSGGAGYVLSREAL 127

  Fly   130 RRYTMASKDPENKECTHWEGYVEGLDIH----------RCLRFANVTVAESRDEFEHETFLPVTM 184
            .|:.              ||:..|:..|          .|::...|...:|||..:.|||.|...
 Frog   128 IRFV--------------EGFRTGICRHITPTEDVAMGNCMQLMGVIAGDSRDTEKRETFNPFAP 178

  Fly   185 DYQFLNGYDTIPWLRKLSYHKRTEKTV----PI-------SSRAICFLVEYPPEMYDYYYFVYRL 238
            :.|.     |:    |.|.||.....|    ||       |..||.:....|..||...||.|..
 Frog   179 ESQL-----TV----KYSEHKENWYWVYCFYPIVEGPQCCSDLAISYHYISPELMYTLEYFTYHF 234

  Fly   239 KIFGTPVR 246
            :.:|...|
 Frog   235 RPYGYQYR 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
LOC100486030XP_002933747.2 Galactosyl_T 9..>159 CDD:304462 50/172 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.