DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34451 and LOC100485879

Sequence 1:NP_001097612.2 Gene:CG34451 FlyBaseID:FBgn0085480 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002933746.2 Gene:LOC100485879 ID: Length:350 Species:Xenopus tropicalis

Alignment Length:259 Identity:77/260 (30%)
Similarity:114/260 (44%) Gaps:41/260 (16%)


  Fly     7 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI-----NSTDT--WTLVQQGLMQAYLFY 64
            |....|.:||.||.:||||.||:|...|.|.    |.|     ...|.  |..: :....|:.:|
 Frog    80 NLQTKAIHVKNTWTRHCNVALFMSSVTDKEF----PTIGLGTGEGRDKLYWKTI-RAFHYAHKYY 139

  Fly    65 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREAL 129
            .::.||||:.:..|:.:::|||:|:  ..|.|.||||||...:... .:.::...:|||:|||||
 Frog   140 LNETDWFLKADDDSYAIVDNLRWML--SNYTPDQPIYFGKRFKPFF-KQGYMSGGAGYVLSREAL 201

  Fly   130 RRYTMASKDPENKECTHWEGYVEGLDIH----------RCLRFANVTVAESRDEFEHETFLPVTM 184
            .|:.              ||:..|:..|          .|::...||..:|||..:.|||.|.:.
 Frog   202 IRFV--------------EGFRTGICTHTTPKEDVAMGNCMQLMGVTAGDSRDTEKRETFNPFSP 252

  Fly   185 DYQFLNGYDTIP--WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVR 246
            :......|....  |....|::...|.....|..||.:...||..||...||.|..:.:|...|
 Frog   253 ESHLTVKYSEHKENWYWSYSFYPIVEGPQCCSDLAISYHYIYPELMYTLEYFTYHFRPYGYQYR 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34451NP_001097612.2 None
LOC100485879XP_002933746.2 Galactosyl_T 83..>233 CDD:304462 51/172 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.