DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34370 and W02G9.4

DIOPT Version :8

Sequence 1:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster
Sequence 2:NP_503727.1 Gene:W02G9.4 / 178731 WormBaseID:WBGene00020954 Length:288 Species:Caenorhabditis elegans

Alignment Length:247 Identity:60/248 (24%)
Similarity:94/248 (38%) Gaps:74/248 (30%)


  Fly   173 FISETSYVKVLFHTDNFT---DQTYFTFDSRAEQQTEVY------------LRYGQHP--ELY-- 218
            |::|.|| .||...::.|   |:|.|..|.:|.|.|.|:            :||...|  .:|  
 Worm    61 FLTEDSY-DVLTIENSTTVSGDKTGFALDIQASQVTLVFTSDLTNTFRGFLIRYDSVPVGSVYMP 124

  Fly   219 PNRRGEVVQGSYCEREYRDCRLQTCYVQSPAYPGLYPRALNCRYKLHTRQPYIKLYLQNEQFAV- 282
            .|....::..|..:           .:.||.:|..||..::|.:.:......:..:    ||.. 
 Worm   125 TNLCSSILHNSEFD-----------IITSPNFPYNYPDNISCAFLIKVSADRLISF----QFVAF 174

  Fly   283 ---DGQRCENVMTCPIRPIGSGNEHCPYDWLAVYDGRDEHSPLIGKFCGLGKFPFSIIGTSQYMY 344
               ||                      ||.::||||.:..:||||.:.| ...|..|..||..:|
 Worm   175 NTEDG----------------------YDVVSVYDGANTSAPLIGHYSG-KNMPAPITSTSNTLY 216

  Fly   345 V----EFVTSPAG-PLLNTGF---HFNVGNWPGHVETAGI----KHGVCDWL 384
            :    :.||:.:| ..|.|.|   :|..|..|..:.|..:    ...:.|||
 Worm   217 LCFSSDLVTNFSGFSGLYTSFVSNNFKRGVLPQSLTTDSVAIRRDKNILDWL 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34370NP_001097404.2 CUB 88..195 CDD:238001 9/25 (36%)
CUB 244..363 CDD:238001 33/131 (25%)
CUB 407..509 CDD:238001
W02G9.4NP_503727.1 CUB 24..113 CDD:238001 16/53 (30%)
CUB 128..236 CDD:238001 32/146 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45645
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.