DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and LIPG

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens

Alignment Length:323 Identity:95/323 - (29%)
Similarity:143/323 - (44%) Gaps:43/323 - (13%)


  Fly    52 QTRDDP------IQLDPLNPQKDV-FQPRLPLKILIHGFIGN-------RNLTPNLEVRDVLLQT 102
            :|..||      :.:....|.:|. |........:|||:..:       ..|...|..|:     
Human    90 RTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTRE----- 149

  Fly   103 QPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAG 167
            :..||:.||:..|...  .|..||||..:|...:|:|::.|.........::||||:||||.|||
Human   150 KDANVVVVDWLPLAHQ--LYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAG 212

  Fly   168 MVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSM----LPPMGHAD 228
            ...|:|...:.||||||||||.| ....:.::|...||||||::||....|.:    ..|:||.|
Human   213 YAGNFVKGTVGRITGLDPAGPMF-EGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID 276

  Fly   229 FYPNLDQLNQRGC---------SYISNWRFYNCNHYRAAVYYGESIIS-ERGFWAQQCGGWFDFF 283
            .|||.... |.||         :|.:......|.|.||...:.:|::: ::..:|.||.....|.
Human   277 IYPNGGDF-QPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFK 340

  Fly   284 SQRC-SHYSNMPNTQMGYFVSE---DASGSYFLTTHEVAPFAKGPLVEVEFDVSELRNFTEIE 342
            ...| |...|..|: :||...:   ..:...:|.|....|| :....:::..|...:|..|||
Human   341 KGICLSCRKNRCNS-IGYNAKKMRNKRNSKMYLKTRAGMPF-RVYHYQMKIHVFSYKNMGEIE 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 88/295 (30%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 88/295 (30%)
lipo_lipase 86..521 CDD:132274 95/323 (29%)
PLAT_LPL 383..519 CDD:238856 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.