DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Pnlip

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_081201.2 Gene:Pnlip / 69060 MGIID:97722 Length:465 Species:Mus musculus

Alignment Length:314 Identity:100/314 - (31%)
Similarity:149/314 - (47%) Gaps:43/314 - (13%)


  Fly    41 NSRVSFWLYTNQTRDD--PIQLDPLNPQKDVFQPRLPLKILIHGFI--GNRNLTPNLEVRDVLLQ 101
            |:|  |.||||:..|:  .|..|..|.:...|:.....:|:|||||  |..|...::...  :.:
Mouse    52 NTR--FLLYTNENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKN--MFR 112

  Fly   102 TQPINVISVDY--GTLVRWPCYYPWAVNNAPIVSECLAQMINNLIS-AGISRREDIHLIGFSLGA 163
            .:.:|.|.||:  |:...    |..|..|..:|...:|.::|.|.| .|.| ..::||||.|||:
Mouse   113 VESVNCICVDWKGGSRTT----YTQATQNVRVVGAEVALLVNVLQSDLGYS-LNNVHLIGHSLGS 172

  Fly   164 QVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTD--PFF----FSMLP 222
            .:||.........:.||||||||.|.|...|. :.:||.:||.|||.||||  |..    |.|..
Mouse   173 HIAGEAGKRTFGAIGRITGLDPAEPYFQGTPE-EVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQ 236

  Fly   223 PMGHADFYPNLDQLNQRGC-----SYISN----W----RFYNCNHYRAAVYYGESIISERGFWAQ 274
            .:||.||:|| ..:...||     |.|.:    |    .|..|||.|:..:|.:||::..||...
Mouse   237 TVGHLDFFPN-GGIEMPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGF 300

  Fly   275 QCGGWFDFFSQRCSHYSNMPNTQMGYFV------SEDASGSYFLTTHEVAPFAK 322
            .|..:..|.:.:|....:....|||::.      :.....:::|.|.:.:.||:
Mouse   301 SCSSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFAR 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 96/303 (32%)
PnlipNP_081201.2 Lipase 18..352 CDD:278576 98/310 (32%)
Pancreat_lipase_like 51..348 CDD:238363 98/306 (32%)
PLAT_PL 355..465 CDD:238857 100/314 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116071475
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.