DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and pnliprp2

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001015812.1 Gene:pnliprp2 / 548529 XenbaseID:XB-GENE-5776210 Length:471 Species:Xenopus tropicalis

Alignment Length:368 Identity:112/369 (30%)
Similarity:159/369 (43%) Gaps:75/369 (20%)


  Fly    10 LLTIVSGFCKGEN--HTR-GWLPEFCVVGE------QKCPNS----RVSFWLYTNQTRDDPIQLD 61
            |:.:.|||.:|..  :.| |..|:....|.      .:.|:|    ...|.|:|.:..|...::.
 Frog     7 LILLTSGFVQGGQVCYERIGCFPDEAPWGGTVQRPIARLPDSPEHINTRFLLFTKENPDTFQEIR 71

  Fly    62 PLNP---QKDVFQPRLPLKILIHGFIG---NRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWP- 119
            .|.|   ....|:.....:.:|||||.   :|.||   .:...||:.:.:|...||      |. 
 Frog    72 ALTPGAISTSNFKASRKTRFIIHGFIEHGYDRWLT---HMCATLLKVEDVNCFCVD------WTG 127

  Fly   120 ---CYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARIT 181
               ..|..|.||..:|...:|..|..|.:.......::|:||.|||:..||..... :..:||||
 Frog   128 GAYALYSQAANNVRVVGAEVAHFIQFLSNQYGYSAANVHVIGHSLGSHAAGETGKR-TPGIARIT 191

  Fly   182 GLDPAGPGFMMQPSLQQKLDASDADFVDIIHTD-----PFF-FSMLPPMGHADFYPNLDQLNQRG 240
            |||||||.|...|. :.:||.|||..||:||||     |.. |.:...:||.|||||..: |..|
 Frog   192 GLDPAGPFFQNTPP-EVRLDQSDAQLVDVIHTDASAIFPLTGFGIGQSVGHLDFYPNGGK-NMPG 254

  Fly   241 C------SYISNWRFYN-------CNHYRAAVYYGESIISERGFWA--------QQCGGWFDFFS 284
            |      .|:.|:|.:.       |:|.|:..:|.|||::...|.|        .:.|..|...|
 Frog   255 CKKSPTLKYLDNYRIFKGSKEIIFCSHIRSYKFYTESILTPDAFVAFPSSDYKTFKKGTGFPCPS 319

  Fly   285 QRCSHYSNMPNTQMGYFVSE---DASG--SYFLTTHEVAPFAK 322
            ..|        ..||::..|   ..||  |:||.|....|||:
 Frog   320 GGC--------PLMGHYAEEFLGPTSGNLSFFLNTGNSEPFAR 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 98/314 (31%)
pnliprp2NP_001015812.1 Lipase 18..352 CDD:278576 105/354 (30%)
PLAT 355..466 CDD:320707 112/369 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.