DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and PNLIPRP1

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens

Alignment Length:329 Identity:111/329 - (33%)
Similarity:156/329 - (47%) Gaps:53/329 - (16%)


  Fly    27 WLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQL----DPLNPQKDVFQPRLPLKILIHGFIGNR 87
            |.||  .:|.:        |.||||:..:: .|:    ||...:...||.....:.:|||||...
Human    47 WSPE--KIGTR--------FLLYTNENPNN-FQILLLSDPSTIEASNFQMDRKTRFIIHGFIDKG 100

  Fly    88 NLTPNLEVRDVLLQTQPINVISVDYGTLVRW----PCYYPWAVNNAPIVSECLAQMINNLISAGI 148
            :.:...::...|.:.:.:|.|.||      |    ...|..|.||..:|...:|||::.|::...
Human   101 DESWVTDMCKKLFEVEEVNCICVD------WKKGSQATYTQAANNVRVVGAQVAQMLDILLTEYS 159

  Fly   149 SRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHT 213
            .....:||||.||||.||| .|...:..|:|||||||....|...|. :.:||.|||||||:|||
Human   160 YPPSKVHLIGHSLGAHVAG-EAGSKTPGLSRITGLDPVEASFESTPE-EVRLDPSDADFVDVIHT 222

  Fly   214 D-----PFF-FSMLPPMGHADFYPNLDQLNQRGC-----SYISN----WR----FYNCNHYRAAV 259
            |     ||. |.....|||.||:||..: :..||     |.|.:    |.    |..|||.|:..
Human   223 DAAPLIPFLGFGTNQQMGHLDFFPNGGE-SMPGCKKNALSQIVDLDGIWAGTRDFVACNHLRSYK 286

  Fly   260 YYGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGS------YFLTTHEVA 318
            ||.|||::..||.|..|..:..|.|.:|....:....|||::..:.|..:      :||.|.|.:
Human   287 YYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEAS 351

  Fly   319 PFAK 322
            .||:
Human   352 NFAR 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 104/304 (34%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 109/325 (34%)
Pancreat_lipase_like 52..349 CDD:238363 105/314 (33%)
PLAT_PL 356..467 CDD:238857 111/329 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115834768
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.