DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and PLA1A

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_056984.1 Gene:PLA1A / 51365 HGNCID:17661 Length:456 Species:Homo sapiens

Alignment Length:331 Identity:107/331 - (32%)
Similarity:154/331 - (46%) Gaps:51/331 - (15%)


  Fly    43 RVSFWLYTNQTRDDPIQLDPLNP------------QKDVFQPRLPLKILIHGF--IGNRNLTPNL 93
            :|.|.|:.           |.||            |...|...|..|::||||  :|.:....:.
Human    50 KVQFLLFV-----------PSNPSCGQLVEGSSDLQNSGFNATLGTKLIIHGFRVLGTKPSWIDT 103

  Fly    94 EVRDVLLQTQPINVISVD--YGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHL 156
            .:| .||:....|||:||  ||:.   ..|:. ||.|...:|..::..:|.|:..|:| ...||:
Human   104 FIR-TLLRATNANVIAVDWIYGST---GVYFS-AVKNVIKLSLEISLFLNKLLVLGVS-ESSIHI 162

  Fly   157 IGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSML 221
            ||.||||.|.|||.......|.:|||||||||.: .:.|::::|||.||.||:.||||.....:.
Human   163 IGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEY-TRASVEERLDAGDALFVEAIHTDTDNLGIR 226

  Fly   222 PPMGHADFYPNLDQLNQRGCS--YISNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFS 284
            .|:||.|::.|..| :|.||.  :.:.:.:..|:|.||...|..::.:.....|..|..:..|.:
Human   227 IPVGHVDYFVNGGQ-DQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLA 290

  Fly   285 QRCSHYSN-----MPN---TQMGYFVSEDASGS---YFLTTHEVAPFAKGPLVEVEFDVSELRN- 337
            .||....|     .|.   .:.|....|.....   |.|||.. ||:.....: |||.:.|||| 
Human   291 GRCLDCFNPFLLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSS-APYCMHHSL-VEFHLKELRNK 353

  Fly   338 FTEIEL 343
            .|.||:
Human   354 DTNIEV 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 95/300 (32%)
PLA1ANP_056984.1 Lipase 16..336 CDD:278576 96/305 (31%)
Pancreat_lipase_like 49..332 CDD:238363 94/300 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.