DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and liph

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001011098.1 Gene:liph / 496511 XenbaseID:XB-GENE-5847665 Length:460 Species:Xenopus tropicalis

Alignment Length:263 Identity:77/264 (29%)
Similarity:127/264 (48%) Gaps:34/264 (13%)


  Fly    43 RVSFWLYTNQTRDDPIQLDPLN------------PQKDVFQPRLPLKILIHGFIGNRNLTPNLEV 95
            :|...||   ||::|.....||            .::.||        :.||:  ....:|.:.:
 Frog    46 KVQLLLY---TRENPKCAQDLNVDNSTGFQYLNVTRRTVF--------ITHGY--RPTGSPPVWI 97

  Fly    96 RDVL---LQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLI 157
            .|::   |..|..|||.||:........|:..|.|... |::.|.:.|:|::|.| :..:.|:::
 Frog    98 DDIVKKFLDIQDFNVIVVDWNRGATTVLYHNAAANTRK-VADILKRFIDNMLSQG-ATLDSIYMV 160

  Fly   158 GFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLP 222
            |.||||.::|.|....:..:.||||||||||.|..:|. :::|..:||.|||::|:|........
 Frog   161 GVSLGAHISGFVGKMYNGSIGRITGLDPAGPLFNGKPP-EERLHYTDAQFVDVVHSDTDGLGYKE 224

  Fly   223 PMGHADFYPNLDQLNQRGC--SYISNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQ 285
            .:||.||||| ...:|.||  :.::...::.|:|.|:...|..|:.......|..|..:.|:...
 Frog   225 SLGHIDFYPN-GGTDQPGCPKTILAGSEYFKCDHQRSVFLYIASLTKSCDLVAFPCKSYRDYRIG 288

  Fly   286 RCS 288
            .|:
 Frog   289 NCT 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 77/263 (29%)
liphNP_001011098.1 Pancreat_lipase_like 45..312 CDD:238363 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.