| Sequence 1: | NP_001097059.1 | Gene: | CG34448 / 5740554 | FlyBaseID: | FBgn0085477 | Length: | 344 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_651403.1 | Gene: | CG4582 / 43086 | FlyBaseID: | FBgn0039344 | Length: | 432 | Species: | Drosophila melanogaster | 
| Alignment Length: | 284 | Identity: | 85/284 - (29%) | 
|---|---|---|---|
| Similarity: | 135/284 - (47%) | Gaps: | 25/284 - (8%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    52 QTRDDPIQL-DPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNLEVRDVL--LQTQPINVISVDYG 113 
  Fly   114 TLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYV-SQPL 177 
  Fly   178 ARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCS 242 
  Fly   243 YISNWRFYNCNHYRAAVYYGESIISER--GFWAQQC--GGWFDFFS-QRCSHYSNMPNTQMGYFV 302 
  Fly   303 SEDA------SGSYFLTTHEVAPF 320  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG34448 | NP_001097059.1 | Pancreat_lipase_like | 44..316 | CDD:238363 | 84/278 (30%) | 
| CG4582 | NP_651403.1 | Pancreat_lipase_like | 138..409 | CDD:238363 | 84/278 (30%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45445935 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28N19 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR11610 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.930 | |||||