DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and sxe2

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster

Alignment Length:314 Identity:84/314 - (26%)
Similarity:139/314 - (44%) Gaps:69/314 - (21%)


  Fly    48 LYTNQTRDDPIQLDPLNPQK-------DV-------FQPRLPLKILIHGFIGNRNLTPNLEVRDV 98
            |||           ||||::       |:       |.|:.|:::.|||:.|......|..::|.
  Fly    75 LYT-----------PLNPEERQLLRPGDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDA 128

  Fly    99 LLQTQPINVISVDYGTLVRW-----PCYYPWAVNNAPIVSECLAQMINNL-ISAGISRREDIHLI 157
            .|.....|||.:|      |     ...||......|.::..:|:|:..| .:.|:. .|.|::|
  Fly   129 YLSRGNYNVIILD------WSRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVP-YEQIYMI 186

  Fly   158 GFSLGAQVAGMVANYVSQP--LARITGLDPAGPGFMMQPSL--QQKLDASDADFVDIIHTDPFFF 218
            |.|.|:.::|:....: :|  |..|..|||||   :.|.||  :::||.:||.:|:.||||   .
  Fly   187 GHSAGSHISGLTGKLL-RPHRLGAIFALDPAG---LTQLSLGPEERLDVNDALYVESIHTD---L 244

  Fly   219 SML----PPMGHADFYPNLDQLNQRGCSYISNWRF-YNCNHYRAAVYYGESIISERGFWAQQCGG 278
            ::|    ..:.||.|:.|.. |.|..|...:...| :.|:|:.|..|:.||:...:.|.|.:|..
  Fly   245 TLLGNPSTKLSHASFFANWG-LGQPHCPNATATEFDFVCDHFAAMFYFAESVRQPKSFAALRCSS 308

  Fly   279 WFDFFSQRCSHYSNMPNTQ------------MGYFVSEDASGSYFLTTHEVAPF 320
            .....|..|:  .|:..::            ||...:....|.::|:|...:|:
  Fly   309 AKSVLSATCN--CNVGGSEKYAVNTCTGNEFMGGEPAVPKRGIFYLSTRPQSPY 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 83/308 (27%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 83/312 (27%)
Pancreat_lipase_like 72..356 CDD:238363 83/308 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116063351
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.