DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG13282

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster

Alignment Length:327 Identity:116/328 (35%)
Similarity:161/328 (49%) Gaps:47/328 (14%)


  Fly    13 IVSGFCKGENHTRGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPI---------QLDPLNPQKD 68
            |..|.||       |     .:| :.||:..|.:::|   ||.:|:         .|:..|....
  Fly    59 ITIGPCK-------W-----AIG-RSCPDPDVKYYIY---TRHNPMDRQCLHIDESLEKSNLTDS 107

  Fly    69 VFQPRLPLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVS 133
            .|.||.|.||:|||:..:..|.|..::|:..|.....|:|.||:..|...|||.. ||:|.....
  Fly   108 YFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPCYIS-AVHNTKHAG 171

  Fly   134 ECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVA-NYVSQPLARITGLDPAGPGFMMQPSLQ 197
            .|.||::..|:..|   ..|||:|||||||||...:| |..|..|.||||||||.|.|:.. ...
  Fly   172 TCTAQLVERLVETG---NTDIHVIGFSLGAQVPNYIARNLSSFMLPRITGLDPAMPLFITS-GKA 232

  Fly   198 QKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCS--YISNWRFYNCNHYRAAVY 260
            .|||.|||.:||:|||:......:...||||||.| ..:.|.||:  .|::   :.|:|.||..|
  Fly   233 DKLDPSDASYVDVIHTNALVQGKMERCGHADFYMN-GGIMQPGCNGQKINS---FACSHQRAPAY 293

  Fly   261 YGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNT----QMGYFVSEDASGSYFLTTHEVAPFA 321
            :.|||.|.:|||...|.|:..:....|      |.|    :.|..:.....|.:.:.|::.:|||
  Fly   294 FLESIRSPKGFWGWACSGYISYLLGMC------PPTNFLLEAGENIRPTTRGMFMIDTNDSSPFA 352

  Fly   322 KG 323
            .|
  Fly   353 LG 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 104/288 (36%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 108/303 (36%)
Pancreat_lipase_like 75..347 CDD:238363 104/290 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134623426
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.