DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG7367

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster

Alignment Length:375 Identity:101/376 (27%)
Similarity:163/376 (43%) Gaps:66/376 (18%)


  Fly     3 IYSTLILLLTIVSGFC---------------KG------ENHTRGWL--------PEFCVVGEQK 38
            :.:|.:::..:::||.               :|      |::.:.|:        ||...:.|..
  Fly    20 VSTTFVVVQWLITGFAALAQVVRPVLLLFGIRGEVALNQEDYNKTWIYMPNGQGKPEVAYLVEPP 84

  Fly    39 CPNSRVS------FWLY-TNQTRDDPIQLDPLN---PQK----------DVFQPRLPLKILIHGF 83
             |.:|::      |.|| ::.:......:|..|   ||:          :.|.|.|..|||:||:
  Fly    85 -PENRINLPQLIKFELYGSDSSSSADFWIDENNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGW 148

  Fly    84 IGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWP-----CYYPWAVNNAPIVSECLAQMINNL 143
            ..:........:|...::...:||.:::      |.     .||.........|...:|::|:.|
  Fly   149 KSSTMSNSIQSIRGAYIERGQVNVFAIN------WKDQADNIYYLTPARYTVQVGRAVAKLIDLL 207

  Fly   144 ISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFV 208
            :....:....|||||.||||.:.|...:|....:.||||||||.|.|......:..||.:||:||
  Fly   208 VEEKDADPNRIHLIGHSLGAHIMGYAGSYTKYRVNRITGLDPARPAFEDCIGPENHLDDTDANFV 272

  Fly   209 DIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESIISERGFWA 273
            |:||:...:.....|:|..|||||.....|.||..:|. .|..|:|.|:..||.|||.|.:||:.
  Fly   273 DVIHSCAGYLGFRKPIGMVDFYPNGGGPPQPGCKELSQ-IFTGCSHGRSYEYYAESINSPKGFYG 336

  Fly   274 QQCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAKG 323
            ..|.|..:...:.|:....:    ||..|..:|.|.:|:.|.....:|.|
  Fly   337 VPCSGLDELKGKNCTGGKIL----MGDPVPREARGIFFVKTANKPSYALG 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 88/297 (30%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134623538
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.