DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG18641

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster

Alignment Length:326 Identity:112/327 (34%)
Similarity:171/327 (52%) Gaps:26/327 (8%)


  Fly    13 IVSGFCKGENHTRGWLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQLDPLNPQK---DVFQPRL 74
            :.:....|:|.|:.::.:.|:....:||:.::.|:|||.:|::.|..:|.|:|..   ..|.||.
  Fly    39 VAAAVAAGQNQTQVYVTDSCLQKPYRCPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRH 103

  Fly    75 PLKILIHGFIGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPC--YYPWAVNNAPIVSECLA 137
            |.||:||||.|.|.|:|:.::|:........|:|.|||...|:.||  ...||..   ..|.|::
  Fly   104 PTKIIIHGFGGGRTLSPSPDLREAYFSVGEYNIIIVDYADAVKEPCLSQMDWAPR---FGSLCIS 165

  Fly   138 QMINNLI--SAGISRREDIHLIGFSLGAQVAGMVANYVSQ---PLARITGLDPAGPGFMMQPSLQ 197
            |::..|.  ..|: :.:|:|.||:|:||.:||:||||:..   .|.|||.|||. ..|....:..
  Fly   166 QLVKYLARHPRGV-QPDDLHFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPT-IFFYAGANNS 228

  Fly   198 QKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGC-SYISNWRFYNCNHYRAAVYY 261
            :.||::||.|||::||...........||||||.| ....|..| ...:.::...|:|.:...|:
  Fly   229 RDLDSTDAHFVDVLHTGAGILGQWHSSGHADFYVN-GGTRQPACVGSATLFQTLACDHTKVTPYF 292

  Fly   262 GESIISERGFWAQQCGGWFDFFSQRC----SHYSNMPNTQMGYFVSEDASGSYFLTTHEVAPFAK 322
            .|||.:.|||:|..|...|.:....|    |.|     ..||...|..|.|:|::||:..||||:
  Fly   293 IESITTTRGFYAGPCPNLFSYLIGWCEPKDSEY-----VLMGEHCSHKARGNYYVTTNAKAPFAR 352

  Fly   323 G 323
            |
  Fly   353 G 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 101/287 (35%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 101/289 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.