DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and pla1a

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio

Alignment Length:374 Identity:112/374 - (29%)
Similarity:165/374 - (44%) Gaps:73/374 - (19%)


  Fly    27 WLPEF-----CV---VGE------QKCPNSRVSFWLYTNQTRDDPIQL----------------D 61
            |:..|     ||   :|:      .||.:...:.||...|.....:|.                |
Zfish     5 WIKAFVYLSVCVTSALGDDEEASASKCADFNNTTWLEYRQATKLQVQYLLLTRKNANCASLFTQD 69

  Fly    62 PLN-PQKDV--FQPRLPLKILIHGF--IGNRNLTPN--LEVRDVLLQTQPINVISVD--YGTLVR 117
            .|| .||..  |...||.|:::||:  :|::   |:  ..:...||:.:.:||:.||  ||....
Zfish    70 CLNHTQKHTAYFNSSLPTKVIVHGYRALGSK---PSWVSGLAQALLREEDVNVLVVDWVYGASFA 131

  Fly   118 WPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITG 182
                |...|.|...|:..::.:||.|...| |..|..|.||.||||.|:|.|.......|.||||
Zfish   132 ----YNLVVENYKEVAVQISVLINQLTKYG-STLESFHFIGVSLGAHVSGFVGTLFHGKLGRITG 191

  Fly   183 LDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCS---YI 244
            ||||||.|...... .:||:|||.||:.||||..:|.:..|:||.||:.| ..::|.||:   :.
Zfish   192 LDPAGPMFKSADPF-DRLDSSDALFVEAIHTDSDYFGISIPVGHVDFFLN-GGMDQAGCARSRFA 254

  Fly   245 SNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPN---TQMGYFVSEDA 306
            |.:.:..|:|.||...|..::..........|.|:.:|.:.:|....:..|   .|:|...:...
Zfish   255 SMYGYVICDHMRALHVYMSALNGSCPLIGFPCSGYEEFLAGKCITCDDPFNGTCPQIGLLKNSGI 319

  Fly   307 SGS--------YFLTTHEVAPFAKGPL----VEVEFDVSELRNFTEIEL 343
            :.:        |.|||      |.||.    :.||.:||.|....|::|
Zfish   320 TATPLPNQEKVYLLTT------ASGPFCAHHILVELNVSRLDKTAEVQL 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 95/310 (31%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 100/334 (30%)
Pancreat_lipase_like 48..336 CDD:238363 92/303 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.