DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and CG6847

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster

Alignment Length:355 Identity:106/355 - (29%)
Similarity:153/355 - (43%) Gaps:89/355 - (25%)


  Fly    35 GEQKCPNSRVSFWLYTNQTRDDPIQLDPLNPQKDVFQPRLPLKILIHGFIGNRNLTPNL---EVR 96
            |.||.|...:          ||....|.|:           :::::|||   .:..|::   |::
  Fly   172 GGQKKPTPSI----------DDLEGFDELS-----------VRVIVHGF---GSACPHVWIYEMK 212

  Fly    97 DVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLIS-AGISRREDIHLIGFS 160
            ..|:..:...||.||:.....:|.|.. |..|..:|.:.||.::.||.. .|:.... .|:||||
  Fly   213 TALMAVEDCIVICVDWENGATFPNYVR-AAANTRLVGKQLAMLLRNLQQHKGLDLMR-THVIGFS 275

  Fly   161 LGAQVAGMVANYVSQPLARITGLDPAGPGFMMQ-PSLQQKLDASDADFVDIIHT--DPFFFSML- 221
            |||.|:|. |......|:||||||||||.|..| |.:  :||:|||:|||:||:  :......| 
  Fly   276 LGAHVSGF-AGAELPGLSRITGLDPAGPLFEAQHPKV--RLDSSDAEFVDVIHSNGENLILGGLG 337

  Fly   222 --PPMGHADFYPNLDQLNQRGCSYISNWRFYN--------------------CNHYRAAVYYGES 264
              .||||.|:|||..:: |.|||.:    |..                    |||.||..::.:|
  Fly   338 SWQPMGHVDYYPNGGRV-QTGCSNL----FVGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDS 397

  Fly   265 IISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQ--------------MGYFVSEDAS-GSYFLTT 314
            :.....|.|..||.:.||...||     .|..|              |||:...... |..:|.|
  Fly   398 VAPRCLFPAFPCGNYDDFLKGRC-----FPCAQDDEDLAEGVPRCGNMGYYADRSTGRGQLYLLT 457

  Fly   315 HEVAPFAKGPLVEVEFDVSELRNFTEIELR 344
            .|..||...     :|.:....:|.::.||
  Fly   458 REEEPFCAH-----QFQLQIFNSFNDLPLR 482

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 95/316 (30%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 100/329 (30%)
Pancreat_lipase_like 185..459 CDD:238363 93/302 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134625620
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.