DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Yp2

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster

Alignment Length:235 Identity:57/235 - (24%)
Similarity:89/235 - (37%) Gaps:35/235 - (14%)


  Fly   102 TQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVA 166
            |:..::|.:..|..:.  .:..:|..|...:.|.:...:..|.:.....:|.|||||....|.||
  Fly   200 TKTGDLIVIQLGNAIE--DFEQYATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVA 262

  Fly   167 GMVANYVSQ----PLARITGLDPAGPGFMMQPSLQQKLDA---SDADFVDIIHTDPFFFSMLPPM 224
            |:.....::    .|.|||.|||.    .:....:::|..   .||||||.|||..:.......:
  Fly   263 GVAGRQFTRQTGHKLRRITALDPT----KIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRL 323

  Fly   225 GHADFYPNLDQLNQRGCSYISNWRFYNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQRCSH 289
            .:.||:||.......|...:.....      ||..|:.||:         :.|...:|.|...|.
  Fly   324 ANVDFFPNGPSTGVPGADNVVEATM------RATRYFAESV---------RPGNERNFPSVAASS 373

  Fly   290 YSNMPNTQ-------MGYFVSEDASGSYFLTTHEVAPFAK 322
            |......:       ||.....|..|.|.|..:..:||.:
  Fly   374 YQEYKQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPFGR 413

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 55/227 (24%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 55/231 (24%)
Abhydrolase <221..407 CDD:304388 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134624346
eggNOG 1 0.900 E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11610
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.