DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Lpl

DIOPT Version :10

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:273 Identity:80/273 - (29%)
Similarity:121/273 - (44%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ILIHGFIGN---RNLTPNLEVRDVLLQTQP-INVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQ 138
            ::|||:...   .:..|.|..  .|.:.:| .|||.||:  |.|...:||.:.....:|...:|:
  Rat    77 VVIHGWTVTGMYESWVPKLVA--ALYKREPDSNVIVVDW--LYRAQQHYPVSAGYTKLVGNDVAR 137

  Fly   139 MINNLISAGISRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGF--MMQPSLQQKLD 201
            .||.|........:::||:|:||||..||:..:..::.:.||||||||||.|  ...||   :|.
  Rat   138 FINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEYAEAPS---RLS 199

  Fly   202 ASDADFVDIIHTDPFFFSMLP--------PMGHADFYPNLDQLNQRGCSYISNWR---------- 248
            ..||||||::||   |....|        |:||.|.|||.... |.||:.....|          
  Rat   200 PDDADFVDVLHT---FTRGSPGRSIGIQKPVGHVDIYPNGGTF-QPGCNIGEAIRVIAEKGLGDV 260

  Fly   249 --FYNCNHYRAAVYYGESIISERG-FWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSE---DAS 307
              ...|:|.|:...:.:|:::|.. ..|.:|.....|....|..........:||.:::   ..|
  Rat   261 DQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGLCLSCRKNRCNNVGYEINKVRAKRS 325

  Fly   308 GSYFLTTHEVAPF 320
            ...:|.|....|:
  Rat   326 SKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 79/267 (30%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 80/273 (29%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 2/22 (9%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.