DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Lipc

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus

Alignment Length:382 Identity:109/383 (28%)
Similarity:165/383 (43%) Gaps:82/383 (21%)


  Fly     1 MSIYSTLILLLTIVSGFCKGENHTRGWLPEFCVVGEQK-CPNSRVSFWLYTNQTRDDPIQLDPLN 64
            :.|..:|:|.:.|.|..|.....|..:........|:| .....:.|.|:.:::.....||.|.:
  Rat     5 LQISVSLVLCIFIQSSACGQGVGTEPFGRNLGATEERKPLQKPEIRFLLFKDESDRLGCQLRPQH 69

  Fly    65 P---QKDVFQPRLPLKILIHGFIGNRNLT-----PNLEVRDVLLQT--------------QPINV 107
            |   |:..|....||.::|||:.|:.:.|     .|....|.||:|              ||:||
  Rat    70 PETLQECGFNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKSRQSQPVNV 134

  Fly   108 ISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRREDIHLIGFSLGAQVAGMVANY 172
            ..||:.:|...  :|..||.|..:|.:.:|.::..|..:....|..:||||:||||.|:|...:.
  Rat   135 GLVDWISLAYQ--HYAIAVRNTRVVGQEVAALLLWLEESMKFSRSKVHLIGYSLGAHVSGFAGSS 197

  Fly   173 V--SQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDPFFFS---------MLPPMGH 226
            :  .:.:.||||||||||.| ...|..::|...||:|||.|||    |:         :..|:.|
  Rat   198 MGGKRKIGRITGLDPAGPMF-EGTSPNERLSPDDANFVDAIHT----FTREHMGLSVGIKQPIAH 257

  Fly   227 ADFYPNLDQLNQRGCSYISNWRF------------YNCNHYRAAVYYGESI----ISERGFWAQQ 275
            .|||||.... |.||.::..::.            ..|.|.|:...:.:|:    :...||   |
  Rat   258 YDFYPNGGSF-QPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSNLQNTGF---Q 318

  Fly   276 CGGWFDFFSQ---------RCSHYSNMPNTQMGYFVSED---ASGSYFLTTHEVAPF 320
            |.. .|.|||         ||:        .:||.:..|   .|.:.||.|...:||
  Rat   319 CSN-MDSFSQGLCLNCKKGRCN--------SLGYDIRRDRPRKSKTLFLITRAQSPF 366

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 98/333 (29%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 104/368 (28%)
Pancreat_lipase_like 47..362 CDD:238363 98/335 (29%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.