DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Pnliprp1

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_061362.1 Gene:Pnliprp1 / 18946 MGIID:97723 Length:473 Species:Mus musculus

Alignment Length:328 Identity:118/329 (36%)
Similarity:157/329 (48%) Gaps:51/329 (16%)


  Fly    27 WLPEFCVVGEQKCPNSRVSFWLYTNQ--TRDDPIQL-DPLNPQKDVFQPRLPLKILIHGFI--GN 86
            |.||..        |:|  |.||||:  |....:|| ||...:...||.....:.:|||||  |.
Mouse    47 WSPEKI--------NTR--FLLYTNENPTAFQTLQLSDPSTIEASNFQVARKTRFIIHGFIDKGE 101

  Fly    87 RNLTPNLEVRDVLLQTQPINVISVDY--GTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGIS 149
            .|..  :::...:.|.:.:|.|.||:  |:...    |..|.||..:|...:||||:.|:.....
Mouse   102 ENWV--VDMCKNMFQVEEVNCICVDWKRGSQTT----YTQAANNVRVVGAQVAQMIDILVRNFNY 160

  Fly   150 RREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTD 214
            ....:||||.||||.||| .|...:..|.|||||||....|...|. :.:||.|||||||:||||
Mouse   161 SASKVHLIGHSLGAHVAG-EAGSRTPGLGRITGLDPVEANFEGTPE-EVRLDPSDADFVDVIHTD 223

  Fly   215 -----PFF-FSMLPPMGHADFYPNLDQLNQRGC-----SYISN----WR----FYNCNHYRAAVY 260
                 ||. |.....:||.||:||..|. ..||     |.|.:    |.    |..|||.|:..|
Mouse   224 AAPLIPFLGFGTNQMVGHFDFFPNGGQY-MPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKY 287

  Fly   261 YGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGS------YFLTTHEVAP 319
            |.|||::..||.|..|..:.||.|.:|....:....|||::..:.|:.:      :||.|.|...
Mouse   288 YLESILNPDGFAAYPCASYRDFESNKCFPCPDQGCPQMGHYADKFANNTSVEPQKFFLNTGEAKN 352

  Fly   320 FAK 322
            ||:
Mouse   353 FAR 355

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 110/304 (36%)
Pnliprp1NP_061362.1 Lipase 18..353 CDD:278576 116/325 (36%)
Pancreat_lipase_like 52..349 CDD:238363 112/316 (35%)
PLAT_PL 356..467 CDD:238857 118/329 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115834630
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.