DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and PNLIPRP3

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens

Alignment Length:329 Identity:107/329 - (32%)
Similarity:151/329 - (45%) Gaps:54/329 - (16%)


  Fly    27 WLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQLDPLNP---QKDVFQPRLPLKILIHGFIGNRN 88
            |.||..        |:|  |.|||....:...::..:|.   |...|......:|.|.|:     
Human    47 WSPEKI--------NTR--FLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGW----- 96

  Fly    89 LTPNLEVRD---VLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISR 150
            .|.....||   ||||.:.||.|::|:   :.....|..||||..:|...:|..|:.|:......
Human    97 KTDGKWQRDMCNVLLQLEDINCINLDW---INGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYS 158

  Fly   151 REDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTDP 215
            ...:||||.||||.:||...:.: ..|.||||||||||.|...|. :.:||.|||:|||:|||:.
Human   159 PSKVHLIGHSLGAHLAGEAGSRI-PGLGRITGLDPAGPFFHNTPK-EVRLDPSDANFVDVIHTNA 221

  Fly   216 --FFFSM----LPPMGHADFYPNLDQLNQRGCSYI------SNWR--------FYNCNHYRAAVY 260
              ..|.:    :...||.|||||..: :..||..:      .|:.        |::|||.|:..:
Human   222 ARILFELGVGTIDACGHLDFYPNGGK-HMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQF 285

  Fly   261 YGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSE------DASGS-YFLTTHEVA 318
            |.|||::...|.|..|..:..|.:..|...|......||:|...      ..:|| |||.|..::
Human   286 YAESILNPDAFIAYPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLS 350

  Fly   319 PFAK 322
            |||:
Human   351 PFAR 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 99/304 (33%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 104/325 (32%)
Pancreat_lipase_like 52..348 CDD:238363 101/316 (32%)
PLAT_PL 355..467 CDD:238857 107/329 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115790295
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.