DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34448 and Pnliprp2

DIOPT Version :8

Sequence 1:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus

Alignment Length:389 Identity:106/390 (27%)
Similarity:156/390 (40%) Gaps:98/390 (25%)


  Fly    27 WLPEFCVVGEQKCPNSRVSFWLYTNQTRDDPIQLDPLNPQK---DVFQPRLPLKILIHGFIGNRN 88
            |.||          :....|.||||:..::..::....|..   ..||.....:.::||||....
  Rat    60 WSPE----------DIDTRFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGE 114

  Fly    89 LTPNLEVRDVLLQTQPINVISVDY--GTLVRWPCYYPWAVNNAPIVSECLAQMINNLISAGISRR 151
            ....|::...:.|.:.:|.|.||:  |:...    |..|..|..:|...:|.::..|.:......
  Rat   115 DGWLLDMCKKMFQVEKVNCICVDWRRGSRTE----YTQASYNTRVVGAEIAFLVQVLSTEMGYSP 175

  Fly   152 EDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGPGFMMQPSLQQKLDASDADFVDIIHTD-- 214
            |::||||.||||.|.|.....:...:.||||||||.|.|...|. :.:||.|||.|||:||||  
  Rat   176 ENVHLIGHSLGAHVVGEAGRRLEGHVGRITGLDPAEPCFQGLPE-EVRLDPSDAMFVDVIHTDSA 239

  Fly   215 ---PFF-FSMLPPMGHADFYPNLDQLNQRGC--SYISN-------W----RFYNCNHYRAAVYYG 262
               |:. |.|...:||.||:||..: ...||  :.:|.       |    .|..|||.|:..||.
  Rat   240 PIIPYLGFGMSQKVGHLDFFPNGGK-EMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYA 303

  Fly   263 ESIISERGFWAQQCGGWFDFFSQRC-----------SHYSNMPN--------------------T 296
            .||::..||....|..:..|....|           .||::...                    |
  Rat   304 SSILNPDGFLGYPCSSYEKFQQNDCFPCPEEGCPKMGHYADQFEGKTATVEQTVYLNTGDSGNFT 368

  Fly   297 QMGYFVSEDASGS-----YFLTT----------HEVAPFAKGPL---------VEVEFDVSELR 336
            :..|.||...||:     |.|..          :|:   .||.|         ::|:.:|.|::
  Rat   369 RWRYKVSVTLSGAKKLSGYILVALYGNNGNSKQYEI---FKGSLKPEARHVRDIDVDINVGEIQ 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 96/342 (28%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 91/323 (28%)
Pancreat_lipase_like 65..363 CDD:238363 88/304 (29%)
PLAT_PL 370..482 CDD:238857 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11610
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.