DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34260 and CG33632

Sequence 1:NP_001262120.1 Gene:CG34260 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster

Alignment Length:128 Identity:31/129 (24%)
Similarity:55/129 (43%) Gaps:18/129 (14%)


  Fly    32 CQIIAKAYVNSLECLL--VRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMN-----IADI 89
            |:.:.|.:.....|.|  |.:....|::|..|.: |....:...|.|.|    |:|     :.::
  Fly    33 CETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLK-IPVTKIKVQFGLYK----RLNGYKPFLYNM 92

  Fly    90 KIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISDE------FPPG 146
            .:|||::|.|...|.|....:...|..||:..:||.:...:.:..:|..|:.:      ||.|
  Fly    93 TLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFPEG 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 22/86 (26%)
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.