DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34260 and CG33632

DIOPT Version :10

Sequence 1:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster


Alignment Length:128 Identity:31/128 - (24%)
Similarity:55/128 - (42%) Gaps:18/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CQIIAKAYVNSLECLL--VRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMN-----IADI 89
            |:.:.|.:.....|.|  |.:....|::|..|.: |....:...|.|.|    |:|     :.::
  Fly    33 CETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLK-IPVTKIKVQFGLYK----RLNGYKPFLYNM 92

  Fly    90 KIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISDE------FPPG 146
            .:|||::|.|...|.|....:...|..||:..:||.:...:.:..:|..|:.:      ||.|
  Fly    93 TLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFPEG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:461928 22/85 (26%)
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 21/82 (26%)

Return to query results.
Submit another query.