DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34260 and CG33723

Sequence 1:NP_001262120.1 Gene:CG34260 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster

Alignment Length:145 Identity:29/146 (20%)
Similarity:53/146 (36%) Gaps:24/146 (16%)


  Fly     1 MLARLSFFLIFLPLQLGLAKNNYDIAIKTLGCQIIAKAYVNSLECLLVRQRTAVVAVKFSLNQTI 65
            |..:|:..:..|.|.|.:.:....:....|.|:.:.|.:....:|.|.           |:|:|.
  Fly     2 MYTKLTLLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLK-----------SINRTY 55

  Fly    66 EHFDVLATFDLIKKDKSRMNIADIK-------------IDGCKYLGSMYQNNIVGKLFKRLKSVS 117
            ::.....:...:...|:|:|....|             :|.|.:......|.:....|..:|..|
  Fly    56 KYISTKVSLHKLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYS 120

  Fly   118 NLPDSCPVSKGKLYE 132
            ||..|||.:...:.|
  Fly   121 NLNHSCPYNNDIIVE 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 16/74 (22%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.