DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34260 and CG33626

Sequence 1:NP_001262120.1 Gene:CG34260 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster

Alignment Length:145 Identity:37/146 (25%)
Similarity:65/146 (45%) Gaps:4/146 (3%)


  Fly    32 CQIIAKAYVNSLECLLVRQRTAVVAVKFSLNQTIEHFDVLATFDL-IKKDKSRMNIADIKIDGCK 95
            || :...|.:.:.|.:...|.:::.|:..|...::...|...... .|.........||..|||:
  Fly    25 CQ-MGPHYADQMTCQIGGTRRSLLNVELKLLTELDQIKVYIKISTRFKSTTLYRKFFDITFDGCR 88

  Fly    96 YLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISDEFPPGAPQAKWQVRLKLLK 160
            .:..|.|..:|..:|..:...||.|..|||:||.:| ..|.: |.|..|...|.|:..:::....
  Fly    89 VISDMVQGTMVSNMFNAVVKSSNQPRKCPVNKGTIY-YHNIS-IEDALPMFVPSAQLFIQIDFYA 151

  Fly   161 RSELVADISIEGAVV 175
            |.:|..::|:.|.::
  Fly   152 RRQLYLNVSLRGEII 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 25/82 (30%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.