DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34260 and CG33927

DIOPT Version :10

Sequence 1:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:164 Identity:37/164 - (22%)
Similarity:75/164 - (45%) Gaps:17/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LARLSFFLIFLPLQLGLAKNNYD-IAIKTLGCQIIAKAYVNSLECLL--VRQRTAVVAVKFSLNQ 63
            ::.:.:.::|..:.|.|...|.. .......|..:.:.::...:|.|  :|:.|..::...::.:
  Fly     4 VSNVLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLK 68

  Fly    64 TIEHFDVLATFDLIKKDKSRMN-----IADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSC 123
            ||..|.|..  .:.|    |.|     :.:|..|||::|...|:..:: .:|..|||.|||..:|
  Fly    69 TISKFRVHG--QIFK----RANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTC 126

  Fly   124 PVSKGKLYEIRNYTFISDEFPPGAPQAKWQVRLK 157
            |. .|.:: |.....|.::.|...|..::.:::|
  Fly   127 PY-MGPVH-IMGLHIIGEQIPVPLPTGEYLIQIK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:461928 23/85 (27%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 24/88 (27%)

Return to query results.
Submit another query.