DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34260 and CG30050

Sequence 1:NP_001262120.1 Gene:CG34260 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster

Alignment Length:152 Identity:35/153 (23%)
Similarity:65/153 (42%) Gaps:6/153 (4%)


  Fly    23 YDIAIKTLGCQIIAKAYVNSLECLLVRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMNIA 87
            |.|.:|.:.| :....|..:|.|.::..:...:....::.|.:..|.......:....|....|.
  Fly    29 YYIEMKQMDC-VGNPNYFANLYCRIIPPKNRTMEASVNIMQQLSVFSGSLRVSIPNAKKVITQIF 92

  Fly    88 DIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPD-SCPVSKGKLYEIRNYTFISDEFPPGAPQAK 151
            ||..|.||.|....:..::..|...|...||... .||..||| :|.||.: ::| .||...:::
  Fly    93 DITFDVCKVLRERKRKILIDLLVNTLAKNSNAKAWRCPFPKGK-FESRNIS-VTD-LPPMLTESE 154

  Fly   152 WQVRLK-LLKRSELVADISIEG 172
            :.|.|. .:.:..:..::::.|
  Fly   155 FFVNLDFFIPKVAIAMNVTLHG 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 23/82 (28%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.