DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment inaF-C and inaF-A

DIOPT Version :10

Sequence 1:NP_001096959.1 Gene:inaF-C / 5740497 FlyBaseID:FBgn0085350 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001096960.1 Gene:inaF-A / 5740676 FlyBaseID:FBgn0085351 Length:89 Species:Drosophila melanogaster


Alignment Length:58 Identity:19/58 - (32%)
Similarity:31/58 - (53%) Gaps:8/58 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VPKSPQLEEIVFAEPTYTE-RFARYFVIVIYLCGLCSLGFFLSIYHIFFWDSRMPPVY 130
            :||..|       .|.:.| :..|...|.:||.|:..||..|::|::.|:||.||.::
  Fly    20 LPKEQQ-------PPAFFESKTFRIISIFLYLGGISGLGMVLALYYLMFFDSSMPDIH 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
inaF-CNP_001096959.1 InaF-motif 92..126 CDD:464449 13/34 (38%)
inaF-ANP_001096960.1 InaF-motif 32..66 CDD:464449 12/33 (36%)

Return to query results.
Submit another query.