DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrn3

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_110483.1 Gene:Lrrn3 / 81514 RGDID:71066 Length:707 Species:Rattus norvegicus

Alignment Length:398 Identity:114/399 (29%)
Similarity:191/399 (48%) Gaps:38/399 (10%)


  Fly    21 IPVLLLLLLTLVILPPETTAFCPSKCQC----------LGGEANSRALCVDAALEDVPIQLNPET 75
            |.|||.|.:|.::...:....||..|.|          :..|| |...|.|..|.:.|.:|..:|
  Rat     8 IHVLLGLAITALVQAGDKKVDCPQLCTCEIRPWFTPRSIYMEA-STVDCNDLGLLNFPARLPADT 71

  Fly    76 KYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAF 140
            :.:.|..|.|..:|.|..|.:.|..||||||.:.::.:.|.:..|:|.::.|..|.::.|.:...
  Rat    72 QILLLQTNNIARIEHSTDFPVNLTGLDLSQNNLSSVTNINVQKMSQLLSVYLEENKLTELPEKCL 136

  Fly   141 KGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLL 205
            .||:||..|.::.|.:..:.|.|...|.:|:.|.|.:|.:..:....|:.:..||:|:..:|.:|
  Rat   137 YGLSNLQELYVNHNLLSAISPGAFVGLHNLLRLHLNSNRLQMINSKWFEALPNLEILMLGDNPIL 201

  Fly   206 DVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLD 270
            .:...|                        |:.|.:|.:|.:.|..::|:...|..||.:|:.:.
  Rat   202 RIKDMN------------------------FQPLLKLRSLVIAGINLTEVPDDALVGLENLESIS 242

  Fly   271 LSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVD 335
            ..||.|..||...|.|..||.:|:|..|..:::....|.|:.||:||.::.:..|..|||.| ||
  Rat   243 FYDNRLNKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGINNMPELVSIDSLA-VD 306

  Fly   336 N-THLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQKLYLGDNPLQ 398
            | ..|:.:...|||:||.|....|...|.:..:.:.||:|..||.... .:..|:::.:..||::
  Rat   307 NLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIR 371

  Fly   399 CNCSLLWL 406
            |:|.:.|:
  Rat   372 CDCVIRWI 379

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 7/22 (32%)
LRR_RI 79..327 CDD:238064 68/248 (27%)
leucine-rich repeat 98..121 CDD:275380 9/23 (39%)
LRR_8 120..180 CDD:290566 18/60 (30%)
leucine-rich repeat 122..145 CDD:275380 6/23 (26%)
leucine-rich repeat 146..169 CDD:275380 6/23 (26%)
LRR_8 169..228 CDD:290566 11/59 (19%)
leucine-rich repeat 170..193 CDD:275380 5/23 (22%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
LRR_8 218..276 CDD:290566 12/58 (21%)
leucine-rich repeat 218..265 CDD:275380 9/47 (19%)
LRR_RI <265..406 CDD:238064 47/143 (33%)
LRR_8 265..321 CDD:290566 19/56 (34%)
leucine-rich repeat 266..289 CDD:275380 8/23 (35%)
leucine-rich repeat 290..313 CDD:275380 6/23 (26%)
leucine-rich repeat 314..338 CDD:275380 11/25 (44%)
LRR_8 337..397 CDD:290566 17/61 (28%)
leucine-rich repeat 339..360 CDD:275380 8/21 (38%)
Lrrn3NP_110483.1 LRRNT 28..72 CDD:214470 13/45 (29%)
LRR 1 70..91 7/21 (33%)
leucine-rich repeat 72..93 CDD:275380 6/21 (29%)
LRR_8 93..152 CDD:290566 19/59 (32%)
LRR 2 93..114 8/21 (38%)
leucine-rich repeat 94..117 CDD:275380 9/23 (39%)
LRR 3 117..138 4/21 (19%)
leucine-rich repeat 118..141 CDD:275380 6/23 (26%)
LRR 4 141..162 6/21 (29%)
leucine-rich repeat 142..165 CDD:275380 6/23 (26%)
LRR 5 165..186 5/21 (24%)
leucine-rich repeat 166..189 CDD:275380 5/23 (22%)
LRR_8 173..221 CDD:290566 12/72 (17%)
LRR 6 189..210 7/45 (16%)
leucine-rich repeat 190..213 CDD:275380 8/47 (17%)
LRR_8 213..272 CDD:290566 20/59 (34%)
LRR 7 213..234 5/21 (24%)
leucine-rich repeat 214..237 CDD:275380 7/23 (30%)
LRR 8 237..258 7/21 (33%)
leucine-rich repeat 238..261 CDD:275380 8/23 (35%)
LRR 9 261..282 6/21 (29%)
leucine-rich repeat 262..285 CDD:275380 6/23 (26%)
LRR 10 285..304 8/19 (42%)
leucine-rich repeat 286..310 CDD:275380 11/25 (44%)
LRR 11 310..332 8/22 (36%)
LRR_8 311..370 CDD:290566 17/59 (29%)
leucine-rich repeat 311..333 CDD:275380 8/22 (36%)
LRR 12 335..358 5/23 (22%)
leucine-rich repeat 336..359 CDD:275380 5/23 (22%)
LRRCT 368..419 CDD:214507 5/13 (38%)
Ig 440..513 CDD:299845
fn3 526..593 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000748
OrthoInspector 1 1.000 T131077
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.