DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc15

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_083249.1 Gene:Lrrc15 / 74488 MGIID:1921738 Length:579 Species:Mus musculus

Alignment Length:585 Identity:137/586 (23%)
Similarity:226/586 (39%) Gaps:138/586 (24%)


  Fly    42 CPSKCQCLGGEANSRALCVDAALEDVPIQLN----------------PETKYINLTV-------- 82
            |||:|.|   ...|:..|..|.:..:|..|.                ||.|::|::.        
Mouse    25 CPSECTC---SRASQVECTGAQIVAMPSPLPWNAMSLQILNTHITELPEDKFLNISALIALKMEK 86

  Fly    83 NRIRTLEFSLPFYMK----LEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGL 143
            |.:..:   :|...:    |..|.|:.|.::.|..:.|:..:.|.||.||.|.:..:....|...
Mouse    87 NELANI---MPGAFRNLGSLRHLSLANNKLKNLPVRLFQDVNNLETLLLSNNQLVQIQPAQFSQF 148

  Fly   144 TNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVP 208
            :||..|.|..|.:|.:.......|..|.:|:|.||....|....|:.:..|:||....|||.|:|
Mouse   149 SNLKELQLYGNNLEYIPEGVFDHLVGLTKLNLGNNGFTHLSPRVFQHLGNLQVLRLYENRLSDIP 213

  Fly   209 -----------------------ASNLWHLHA-LKSLDMSLNLVEFVRNDSFEGLKELLALSVQG 249
                                   :..|:|.:. |:.|.:|.|.:..:....|..|..|..|::.|
Mouse   214 MGTFDALGNLQELALQENQIGTLSPGLFHNNRNLQRLYLSNNHISHLPPGIFMQLPHLNKLTLFG 278

  Fly   250 NVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHL 314
            |.:.||....|..:.:|:.|.|.:|::|.:|....|.|:.|..|.|..|:.|.:...||..|.:|
Mouse   279 NSLKELSPGVFGPMPNLRELWLYNNHITSLPDNAFSHLNQLQVLILSHNQLSYISPGAFNGLTNL 343

  Fly   315 RELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYS 379
            |||.| ..:.||.:|...|....:|:.:.|.|| :|..:|..:|.....::.:.:|:|:|:.|..
Mouse   344 RELSL-HTNALQDLDGNVFRSLANLRNVSLQNN-RLRQLPGSIFANVNGLMTIQLQNNNLENLPL 406

  Fly   380 AQFP-VDQLQKLYLGDNPLQCNCSLL----WL----WRLVTG---------------------NF 414
            ..|. :..|.:|.|.|||.:|:.::|    ||    .||.|.                     ||
Mouse   407 GIFDHLGNLCELRLYDNPWRCDSNILPLHDWLILNRARLGTDTLPVCSSPASVRGQSLVIINVNF 471

  Fly   415 EGVD-PGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVNALHTTEPSA 478
            .|.. .|.|.....:....:...|...::.......||||.             ...|:|.||  
Mouse   472 PGPSVQGPETPEVSSYPDTSSYPDSTSISSTTEITRSTDDD-------------YTDLNTIEP-- 521

  Fly   479 YELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPAHIVTVV---CAVITCL 540
                  ..:||:              |.         :|.::..:...|.::.::   |::..|:
Mouse   522 ------IDDRNT--------------WG---------MTDAQSGLAIAAIVIGIIALACSLAACI 557

  Fly   541  540
            Mouse   558  557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 4/30 (13%)
LRR_RI 79..327 CDD:238064 76/284 (27%)
leucine-rich repeat 98..121 CDD:275380 6/23 (26%)
LRR_8 120..180 CDD:290566 19/60 (32%)
leucine-rich repeat 122..145 CDD:275380 7/23 (30%)
leucine-rich repeat 146..169 CDD:275380 6/23 (26%)
LRR_8 169..228 CDD:290566 21/83 (25%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
leucine-rich repeat 194..217 CDD:275380 10/46 (22%)
LRR_8 218..276 CDD:290566 17/58 (29%)
leucine-rich repeat 218..265 CDD:275380 13/47 (28%)
LRR_RI <265..406 CDD:238064 46/146 (32%)
LRR_8 265..321 CDD:290566 21/56 (38%)
leucine-rich repeat 266..289 CDD:275380 8/23 (35%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..338 CDD:275380 9/24 (38%)
LRR_8 337..397 CDD:290566 18/61 (30%)
leucine-rich repeat 339..360 CDD:275380 7/21 (33%)
Lrrc15NP_083249.1 LRR 1 54..75 3/21 (14%)
leucine-rich repeat 58..78 CDD:275380 4/20 (20%)
LRR 2 78..99 2/24 (8%)
LRR_8 82..137 CDD:290566 14/58 (24%)
LRR 3 102..123 6/21 (29%)
leucine-rich repeat 103..126 CDD:275380 6/23 (26%)
LRR_8 126..185 CDD:290566 19/59 (32%)
LRR 4 126..147 7/21 (33%)
leucine-rich repeat 127..150 CDD:275380 7/23 (30%)
LRR 5 150..171 6/21 (29%)
LRR_RI 151..331 CDD:238064 49/180 (27%)
leucine-rich repeat 151..174 CDD:275380 6/23 (26%)
LRR 6 174..195 7/21 (33%)
leucine-rich repeat 175..198 CDD:275380 7/23 (30%)
LRR_8 198..257 CDD:290566 14/59 (24%)
LRR 7 198..219 8/21 (38%)
leucine-rich repeat 199..222 CDD:275380 8/23 (35%)
LRR 8 222..243 2/21 (10%)
leucine-rich repeat 223..246 CDD:275380 2/23 (9%)
LRR_8 245..305 CDD:290566 17/60 (28%)
LRR 9 246..267 5/21 (24%)
leucine-rich repeat 247..270 CDD:275380 6/23 (26%)
LRR 10 270..291 7/21 (33%)
leucine-rich repeat 271..294 CDD:275380 7/23 (30%)
LRR_8 293..353 CDD:290566 21/61 (34%)
LRR 11 294..315 7/21 (33%)
leucine-rich repeat 295..318 CDD:275380 8/23 (35%)
LRR_4 318..358 CDD:289563 16/41 (39%)
LRR 12 318..339 7/21 (33%)
leucine-rich repeat 319..342 CDD:275380 8/23 (35%)
LRR 13 342..363 9/22 (41%)
leucine-rich repeat 343..364 CDD:275380 9/22 (41%)
LRR_8 366..424 CDD:290566 17/59 (29%)
LRR 14 366..387 7/22 (32%)
leucine-rich repeat 367..387 CDD:275380 7/21 (33%)
LRR 15 390..411 5/21 (24%)
leucine-rich repeat 391..412 CDD:275380 5/21 (24%)
LRRCT 423..>462 CDD:214507 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.