DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and TLR3

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_003256.1 Gene:TLR3 / 7098 HGNCID:11849 Length:904 Species:Homo sapiens

Alignment Length:471 Identity:113/472 (24%)
Similarity:186/472 (39%) Gaps:131/472 (28%)


  Fly    44 SKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRTLEFS----------------- 91
            :||..    ::..|.|....|..||..|......:|||.|::|.|..:                 
Human    26 TKCTV----SHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNT 86

  Fly    92 -----------LPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145
                       ||.   |::|:|..|.:..|..|.|.:.:.|..|:|..|.:..:..:.|....|
Human    87 ISKLEPELCQKLPM---LKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKN 148

  Fly   146 LLLLDLSFN-----------RIETVHPTALS------------DL---ASLVELDLTNNNIVSLE 184
            |:.||||.|           ::|.:....||            |:   :||.:|:|::|.|....
Human   149 LITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFS 213

  Fly   185 DNCFKGMNTLEVLVFRNNRL---------LDVPASNLWHLHA--------------------LKS 220
            ..||..:..|..|...|.:|         |::..:::.:|..                    |..
Human   214 PGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTM 278

  Fly   221 LDMSLNLVEFVRNDSF-------------EGLKELLALSVQG--NV------------------M 252
            ||:|.|.:..|.||||             ..::.|.:.|:.|  ||                  :
Human   279 LDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASL 343

  Fly   253 SELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAV---AFLNLFHL 314
            .::|..:|:.|..|:||::.||::..:.:...:.|.||.||:| .|.|:.|..:   .|::|.| 
Human   344 PKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSL-SNSFTSLRTLTNETFVSLAH- 406

  Fly   315 RELHLSRL--DFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTL 377
            ..||:..|  :.:.:|:|.||....||:.|.|..|....::..:.::|..||.|:|:..|....|
Human   407 SPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQL 471

  Fly   378 YSAQFP-VDQLQKLYL 392
            ....|. |..||:|.|
Human   472 TRNSFALVPSLQRLML 487

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 8/50 (16%)
LRR_RI 79..327 CDD:238064 83/369 (22%)
leucine-rich repeat 98..121 CDD:275380 7/23 (30%)
LRR_8 120..180 CDD:290566 21/86 (24%)
leucine-rich repeat 122..145 CDD:275380 5/23 (22%)
leucine-rich repeat 146..169 CDD:275380 10/49 (20%)
LRR_8 169..228 CDD:290566 19/88 (22%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
leucine-rich repeat 194..217 CDD:275380 6/32 (19%)
LRR_8 218..276 CDD:290566 23/91 (25%)
leucine-rich repeat 218..265 CDD:275380 18/80 (23%)
LRR_RI <265..406 CDD:238064 42/135 (31%)
LRR_8 265..321 CDD:290566 19/59 (32%)
leucine-rich repeat 266..289 CDD:275380 6/23 (26%)
leucine-rich repeat 290..313 CDD:275380 9/26 (35%)
leucine-rich repeat 314..338 CDD:275380 7/26 (27%)
LRR_8 337..397 CDD:290566 18/58 (31%)
leucine-rich repeat 339..360 CDD:275380 4/21 (19%)
TLR3NP_003256.1 leucine-rich repeat 33..52 CDD:275380 6/19 (32%)
LRR 1 52..73 6/21 (29%)
leucine-rich repeat 53..76 CDD:275380 6/23 (26%)
PLN00113 72..>542 CDD:331614 99/422 (23%)
LRR 2 76..97 0/21 (0%)
leucine-rich repeat 77..100 CDD:275380 2/23 (9%)
LRR 3 100..121 7/24 (29%)
leucine-rich repeat 101..124 CDD:275380 7/23 (30%)
LRR 4 124..145 5/21 (24%)
leucine-rich repeat 125..148 CDD:275380 5/23 (22%)
LRR 5 148..168 7/20 (35%)
leucine-rich repeat 149..198 CDD:275380 10/49 (20%)
LRR 6 172..193 3/21 (14%)
LRR 7 198..219 8/21 (38%)
leucine-rich repeat 199..249 CDD:275380 12/50 (24%)
LRR 8 222..244 5/22 (23%)
LRR 9 249..270 1/21 (5%)
leucine-rich repeat 250..275 CDD:275380 1/25 (4%)
LRR 10 275..296 10/21 (48%)
leucine-rich repeat 276..299 CDD:275380 10/23 (43%)
LRR 11 299..320 2/21 (10%)
leucine-rich repeat 300..321 CDD:275380 3/21 (14%)
LRR 12 323..344 2/21 (10%)
LRR 13 356..377 5/21 (24%)
leucine-rich repeat 357..380 CDD:275380 6/23 (26%)
LRR 14 380..400 8/21 (38%)
leucine-rich repeat 381..406 CDD:275380 9/26 (35%)
LRR 15 408..429 7/21 (33%)
leucine-rich repeat 409..432 CDD:275380 7/23 (30%)
LRR 16 432..454 5/22 (23%)
leucine-rich repeat 433..457 CDD:275380 5/24 (21%)
leucine-rich repeat 458..481 CDD:275380 7/23 (30%)
LRR 17 465..486 7/21 (33%)
leucine-rich repeat 482..507 CDD:275380 4/7 (57%)
LRR 18 507..528
leucine-rich repeat 508..531 CDD:275380
LRR_RI <531..647 CDD:330982
LRR 19 531..552
leucine-rich repeat 532..563 CDD:275380
LRR 20 563..584
leucine-rich repeat 564..585 CDD:275380
LRR 21 587..608
leucine-rich repeat 588..611 CDD:275380
LRR 22 611..632
leucine-rich repeat 612..630 CDD:275380
PCC 616..>688 CDD:188093
leucine-rich repeat 637..659 CDD:275380
TIR 755..900 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.