DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and LRRTM1

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001102844.1 Gene:LRRTM1 / 679668 RGDID:1585921 Length:523 Species:Rattus norvegicus

Alignment Length:614 Identity:139/615 (23%)
Similarity:234/615 (38%) Gaps:150/615 (24%)


  Fly    23 VLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRT 87
            |:|.||.....:.|...:.||.:|:|.|......||.:..|..::...|....:|.:|  :.:|.
  Rat    20 VVLCLLGACFQMLPAAPSGCPGQCRCEGRLLYCEALNLTEAPHNLSGLLGLSLRYNSL--SELRA 82

  Fly    88 LEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLS 152
            .:|:  ..|:|..|.|..|.|.::....|:....::.|.||.|.::.|....|:.:.||..:|||
  Rat    83 GQFT--GLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTLSSNQITELANTTFRPMPNLRSVDLS 145

  Fly   153 FNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHA 217
            :|:::.:.|            ||            |.|:..|..|..|.|.:..||........:
  Rat   146 YNKLQALAP------------DL------------FHGLRKLTTLHMRANAIQFVPVRIFQDCRS 186

  Fly   218 LKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQ 282
            ||.||:..|.::.:..:||.||.:|..|.::.|.:.:::.:.|..||||..|.|..|.:.:| ..
  Rat   187 LKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLIKVNFAHFPRLISLNSLCLRRNKVAIV-VS 250

  Fly   283 QLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNN 347
            .|..:.||..::|.||.                         ::.::...|....:||:|.|::|
  Rat   251 SLDWVWNLEKMDLSGNE-------------------------IEYMEPHVFETVPYLQSLQLDSN 290

  Fly   348 PQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCN---CSLL-WLWR 408
                    ||....|.||      ||.::|.|          :.|..|...|.   |:|. ||  
  Rat   291 --------RLTYIEPRIL------NSWKSLTS----------ITLAGNLWDCGRNVCALASWL-- 329

  Fly   409 LVTGNFEG-VDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVNA-- 470
               .||:| .|..::       .|..:.|..|::.|...|....:||....:.::....:.|.  
  Rat   330 ---SNFQGRYDANLQ-------CASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAAVTNRSD 384

  Fly   471 LHTTEPSAYELATSSSNRNSGILRMDRQQI-GCDIWRDKVRTRRKLLTMSEGEITCPAHIVTVVC 534
            |...|.||..|.......:...|......| |.:...:.|:..:               :||...
  Rat   385 LAPPESSATTLVDGGEGLHDSTLEPITVAIPGGEHAENAVQIHK---------------VVTGTM 434

  Fly   535 AVITCLLVAMIGISV--------LYYLR--FVKRRRK-----LLHERGPMRTSKSIINVHDRILQ 584
            |:|...|:.::.:.|        |..||  ||.:|||     .:|:...|...:..::       
  Rat   435 ALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQMAAMSAQEYYVD------- 492

  Fly   585 GHNPGGLGLGMSMTLGGGNHVNGLGMTLN 613
             :.|              ||:.|..:.:|
  Rat   493 -YKP--------------NHIEGALVIIN 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 5/22 (23%)
LRR_RI 79..327 CDD:238064 60/248 (24%)
leucine-rich repeat 98..121 CDD:275380 6/23 (26%)
LRR_8 120..180 CDD:290566 15/60 (25%)
leucine-rich repeat 122..145 CDD:275380 6/23 (26%)
leucine-rich repeat 146..169 CDD:275380 6/23 (26%)
LRR_8 169..228 CDD:290566 15/59 (25%)
leucine-rich repeat 170..193 CDD:275380 4/23 (17%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
LRR_8 218..276 CDD:290566 20/58 (34%)
leucine-rich repeat 218..265 CDD:275380 15/47 (32%)
LRR_RI <265..406 CDD:238064 33/145 (23%)
LRR_8 265..321 CDD:290566 12/56 (21%)
leucine-rich repeat 266..289 CDD:275380 6/23 (26%)
leucine-rich repeat 290..313 CDD:275380 4/23 (17%)
leucine-rich repeat 314..338 CDD:275380 1/24 (4%)
LRR_8 337..397 CDD:290566 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 7/21 (33%)
LRRTM1NP_001102844.1 LRR 1 64..87 5/27 (19%)
LRR_8 73..125 CDD:290566 15/56 (27%)
LRR_RI <85..268 CDD:238064 58/235 (25%)
LRR 2 89..111 7/22 (32%)
leucine-rich repeat 91..114 CDD:275380 6/23 (26%)
LRR 3 112..135 6/23 (26%)
LRR_8 113..173 CDD:290566 21/84 (25%)
leucine-rich repeat 115..138 CDD:275380 6/23 (26%)
LRR 4 136..159 10/47 (21%)
leucine-rich repeat 139..162 CDD:275380 10/47 (21%)
LRR_8 161..221 CDD:290566 18/60 (30%)
LRR 5 161..183 6/22 (27%)
leucine-rich repeat 163..186 CDD:275380 6/23 (26%)
LRR 6 184..207 7/23 (30%)
leucine-rich repeat 187..210 CDD:275380 9/23 (39%)
LRR 7 209..231 4/22 (18%)
leucine-rich repeat 211..234 CDD:275380 6/23 (26%)
LRR 8 233..255 8/23 (35%)
leucine-rich repeat 235..257 CDD:275380 6/23 (26%)
LRR 9 256..278 6/47 (13%)
LRR_8 257..315 CDD:290566 22/107 (21%)
leucine-rich repeat 258..281 CDD:275380 5/48 (10%)
LRR 10 280..302 11/36 (31%)
leucine-rich repeat 282..300 CDD:275380 9/26 (35%)
leucine-rich repeat 306..318 CDD:275378 4/22 (18%)
May be involved in DLG4-binding. {ECO:0000250} 520..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.