DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and lrfn5b

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_683575.2 Gene:lrfn5b / 555839 ZFINID:ZDB-GENE-080327-20 Length:765 Species:Danio rerio

Alignment Length:543 Identity:119/544 (22%)
Similarity:184/544 (34%) Gaps:210/544 (39%)


  Fly    23 VLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRT 87
            :|:.|::.::.|..:....||.:|.|.....|...||....|..||..::.            ||
Zfish     4 LLVYLMVVVMALKAQKIQVCPKRCICQVLPPNLATLCDKKGLLFVPPNIDR------------RT 56

  Fly    88 LEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLS 152
            :|           |.|..|.|..:..|:|...::|..|.||||.:.|:..|||..|.||..|.|.
Zfish    57 VE-----------LRLGDNFITGIKRKDFANMTKLVDLTLSRNTIGSVAPHAFNDLENLRALHLD 110

  Fly   153 FNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHA 217
            .||:  .|              :||:.        |.||:.|..|:..||:|.        ::| 
Zfish   111 SNRL--TH--------------ITNDT--------FSGMSKLHHLILNNNQLT--------YIH- 142

  Fly   218 LKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQ 282
                                                   :.||..|::|:.||||.|||...|..
Zfish   143 ---------------------------------------IGAFNDLLALEELDLSYNNLEGAPWI 168

  Fly   283 QLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNN 347
            .:..:.:|..|||..|..:.:|...|           |.|..|:|:|              :.:|
Zfish   169 AIQLMISLHTLNLDHNMINYIPEGTF-----------SGLQKLKRLD--------------VTSN 208

  Fly   348 PQLSDIPMRLFQGNPNILEVYMQSNSLQT---LYSAQFPVDQLQKLYLGDNPLQCNCSLLWLWRL 409
             :|..:|       |:  .|:.::..|.|   |.::.|      .|..|.|||.|||.||||.||
Zfish   209 -KLHKLP-------PD--PVFQRAGVLATSGVLGASTF------ALSFGGNPLHCNCELLWLRRL 257

  Fly   410 VTGNFEGVDPGMEHAAGGAVAALAKE--------------------------------------- 435
            ...:........:|.||.....:::|                                       
Zfish   258 RREDDLETCAAPQHLAGRYFWTVSEEEFLCEPPLITRHSQEMRALEGQQVSLRCKARGDPDPIIH 322

  Fly   436 --ADDEELA-DEATAVASTDDGVAALAAYIAE---------------QHIVNAL-----HTT--- 474
              |.|.:|. :.:..|..||..:..|.:.:.:               |..|:.|     |.|   
Zfish   323 WVAPDGKLVFNSSRTVVHTDGTLEILISTVKDSGSFTCVASNPSGEAQQTVDLLITKLPHFTNDT 387

  Fly   475 ------EPSAYELATSSSNRNSG 491
                  :|.:.::|||:...:.|
Zfish   388 SLAPEPDPGSSDIATSAKTADGG 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 3/22 (14%)
LRR_RI 79..327 CDD:238064 60/248 (24%)
leucine-rich repeat 98..121 CDD:275380 6/23 (26%)
LRR_8 120..180 CDD:290566 20/60 (33%)
leucine-rich repeat 122..145 CDD:275380 11/23 (48%)
leucine-rich repeat 146..169 CDD:275380 6/23 (26%)
LRR_8 169..228 CDD:290566 11/59 (19%)
leucine-rich repeat 170..193 CDD:275380 5/23 (22%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
LRR_8 218..276 CDD:290566 10/58 (17%)
leucine-rich repeat 218..265 CDD:275380 3/47 (6%)
LRR_RI <265..406 CDD:238064 41/144 (28%)
LRR_8 265..321 CDD:290566 17/56 (30%)
leucine-rich repeat 266..289 CDD:275380 9/23 (39%)
leucine-rich repeat 290..313 CDD:275380 7/23 (30%)
leucine-rich repeat 314..338 CDD:275380 5/24 (21%)
LRR_8 337..397 CDD:290566 13/63 (21%)
leucine-rich repeat 339..360 CDD:275380 3/21 (14%)
lrfn5bXP_683575.2 LRR_RI 44..>245 CDD:238064 78/337 (23%)
leucine-rich repeat 56..79 CDD:275380 8/34 (24%)
LRR_8 78..138 CDD:290566 27/84 (32%)
leucine-rich repeat 80..103 CDD:275380 11/23 (48%)
leucine-rich repeat 104..127 CDD:275380 11/47 (23%)
leucine-rich repeat 128..151 CDD:275380 9/71 (13%)
leucine-rich repeat 152..175 CDD:275380 9/23 (39%)
LRR_8 158..210 CDD:290566 18/78 (23%)
LRR_4 175..215 CDD:289563 15/73 (21%)
leucine-rich repeat 176..199 CDD:275380 9/34 (26%)
I-set 290..377 CDD:254352 10/87 (11%)
Ig 304..377 CDD:299845 10/73 (14%)
fn3 426..495 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BH3X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.