DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc32

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001106850.1 Gene:Lrrc32 / 434215 MGIID:93882 Length:663 Species:Mus musculus

Alignment Length:541 Identity:137/542 (25%)
Similarity:205/542 (38%) Gaps:147/542 (27%)


  Fly    23 VLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRT 87
            :|||.:|||.:...:.....|  |:.:    |..|||....|..||..|:.:.:.:.|:.|::::
Mouse     6 LLLLAMLTLGLAISQRREQVP--CRTV----NKEALCHGLGLLQVPSVLSLDIQALYLSGNQLQS 64

  Fly    88 LEFS-LPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVS---SLHKHAFKGLTNLLL 148
            :..| |.||..|..||||.|.|..|.:..|:....|..|||:.|.::   :|:......|..|:.
Mouse    65 ILVSPLGFYTALRHLDLSDNQISFLQAGVFQALPYLEHLNLAHNRLATGMALNSGGLGRLPLLVS 129

  Fly   149 LDLSFNRIE-TVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDV----- 207
            ||||.|.:. .:....|.:...|..|.|..|::..|..:.|.||..:|.|...:|.|:|:     
Mouse   130 LDLSGNSLHGNLVERLLGETPRLRTLSLAENSLTRLARHTFWGMPAVEQLDLHSNVLMDIEDGAF 194

  Fly   208 -PASNLWHLH---------------ALKSLDMSLNLVEFVRND---------SFEGLKE------ 241
             ...:|.||:               .|:.||:|.|.:|..:..         ::..|:|      
Mouse   195 EALPHLTHLNLSRNSLTCISDFSLQQLQVLDLSCNSIEAFQTAPEPQAQFQLAWLDLRENKLLHF 259

  Fly   242 --------LLALSVQGNVM---------SELDLSA-FEG-----------------LISLKHLDL 271
                    |:.|:|..|::         || ||.| .||                 |..|.:|||
Mouse   260 PDLAVFPRLIYLNVSNNLIQLPAGLPRGSE-DLHAPSEGWSASPLSNPSRNASTHPLSQLLNLDL 323

  Fly   272 SDNNLTMVPTQQLSKLSNLTYLNLGGN--------RFSQLPAVAFLNLFH--LRELHLS------ 320
            |.|.:.:||...|..|::|.:|||..|        :...||.:..|:|.|  |..|.|.      
Mouse   324 SYNEIELVPASFLEHLTSLRFLNLSRNCLRSFEARQVDSLPCLVLLDLSHNVLEALELGTKVLGS 388

  Fly   321 ------RLDFLQRIDSRAFVDNTHLQTLHLNNN-------------PQLSDIPMRLFQGNPNILE 366
                  :.:.||.:....|.....||.|:|..|             |...|     |.|.|.:..
Mouse   389 LQTLLLQDNALQELPPYTFASLASLQRLNLQGNQVSPCGGPAEPGPPGCVD-----FSGIPTLHV 448

  Fly   367 VYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWLWRLVTGNFEGVDPGMEHAAGGAVAA 431
            :.|..||:..|.:..|....|.:|.|..||                   |:|     .|.||:..
Mouse   449 LNMAGNSMGMLRAGSFLHTPLTELDLSTNP-------------------GLD-----VATGALVG 489

  Fly   432 LAKEADDEELADEATAVASTD 452
            |....:..||......|...|
Mouse   490 LEASLEVLELQGNGLTVLRVD 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 6/23 (26%)
LRR_RI 79..327 CDD:238064 90/346 (26%)
leucine-rich repeat 98..121 CDD:275380 9/23 (39%)
LRR_8 120..180 CDD:290566 18/64 (28%)
leucine-rich repeat 122..145 CDD:275380 7/26 (27%)
leucine-rich repeat 146..169 CDD:275380 7/24 (29%)
LRR_8 169..228 CDD:290566 21/80 (26%)
leucine-rich repeat 170..193 CDD:275380 8/23 (35%)
leucine-rich repeat 194..217 CDD:275380 8/44 (18%)
LRR_8 218..276 CDD:290566 26/108 (24%)
leucine-rich repeat 218..265 CDD:275380 20/97 (21%)
LRR_RI <265..406 CDD:238064 46/176 (26%)
LRR_8 265..321 CDD:290566 23/78 (29%)
leucine-rich repeat 266..289 CDD:275380 10/23 (43%)
leucine-rich repeat 290..313 CDD:275380 9/31 (29%)
leucine-rich repeat 314..338 CDD:275380 6/36 (17%)
LRR_8 337..397 CDD:290566 20/73 (27%)
leucine-rich repeat 339..360 CDD:275380 8/34 (24%)
Lrrc32NP_001106850.1 LRR_RI 37..278 CDD:330982 61/241 (25%)
LRR 1. {ECO:0000255} 49..72 4/23 (17%)
leucine-rich repeat 55..75 CDD:275380 6/20 (30%)
LRR 2. {ECO:0000255} 73..96 10/23 (43%)
leucine-rich repeat 76..99 CDD:275380 9/23 (39%)
LRR 3. {ECO:0000255} 98..123 6/25 (24%)
leucine-rich repeat 100..126 CDD:275380 7/26 (27%)
PLN00113 123..>562 CDD:331614 100/419 (24%)
LRR 4. {ECO:0000255} 125..148 7/23 (30%)
leucine-rich repeat 127..151 CDD:275380 7/24 (29%)
LRR 5. {ECO:0000255} 149..172 6/23 (26%)
leucine-rich repeat 152..175 CDD:275380 8/23 (35%)
LRR 6. {ECO:0000255} 174..196 5/22 (23%)
leucine-rich repeat 176..199 CDD:275380 5/23 (22%)
LRR 7. {ECO:0000255} 197..220 3/23 (13%)
leucine-rich repeat 200..220 CDD:275380 3/20 (15%)
leucine-rich repeat 221..245 CDD:275380 6/24 (25%)
LRR 8. {ECO:0000255} 222..241 5/19 (26%)
LRR 9. {ECO:0000255} 243..267 2/24 (8%)
leucine-rich repeat 246..267 CDD:275380 2/21 (10%)
LRR 10. {ECO:0000255} 269..287 3/18 (17%)
LRR 11. {ECO:0000255} 315..338 10/23 (43%)
leucine-rich repeat 318..341 CDD:275380 10/23 (43%)
LRR 12. {ECO:0000255} 340..362 5/22 (23%)
leucine-rich repeat 342..365 CDD:275380 7/23 (30%)
LRR 13. {ECO:0000255} 363..386 8/23 (35%)
leucine-rich repeat 366..388 CDD:275380 6/22 (27%)
LRR 14. {ECO:0000255} 387..409 3/22 (14%)
leucine-rich repeat 389..412 CDD:275380 3/23 (13%)
LRR 15. {ECO:0000255} 411..433 5/22 (23%)
leucine-rich repeat 413..445 CDD:275380 10/37 (27%)
LRR 16. {ECO:0000255} 443..466 6/23 (26%)
leucine-rich repeat 446..467 CDD:275380 5/21 (24%)
LRR 17. {ECO:0000255} 468..489 10/45 (22%)
leucine-rich repeat 469..493 CDD:275380 11/48 (23%)
LRR 18. {ECO:0000255} 491..514 4/21 (19%)
leucine-rich repeat 494..516 CDD:275380 4/18 (22%)
LRR 19. {ECO:0000255} 515..539
leucine-rich repeat 517..538 CDD:275380
leucine-rich repeat 539..560 CDD:275380
LRR 20. {ECO:0000255} 541..559
LRR 21. {ECO:0000255} 561..584
leucine-rich repeat 564..576 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.