DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc3b

DIOPT Version :10

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001386424.1 Gene:Lrrc3b / 305705 RGDID:1311897 Length:259 Species:Rattus norvegicus


Alignment Length:165 Identity:51/165 - (30%)
Similarity:79/165 - (47%) Gaps:28/165 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WLCGAIPVLLLL-LLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYIN 79
            ||..::.:.||| ...|:||...:.:.||..|.| .........|.:|.|:::|..|.|||    
  Rat     7 WLSRSLSMCLLLQSFVLMILCFHSASMCPKGCLC-SSSGGLNVTCSNANLKEIPRDLPPET---- 66

  Fly    80 LTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLT 144
                               .:|.|..|.|.::.::.|:...:||.||||:|.:..:.:|||||:.
  Rat    67 -------------------VLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVA 112

  Fly   145 NLL-LLDLSFNRIETVHPTALSDLASLVELDLTNN 178
            ..| .||||.|||::||..|.::|.:...  :.||
  Rat   113 ETLQTLDLSDNRIQSVHKNAFNNLKARAR--IANN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 35/109 (32%)
leucine-rich repeat 75..97 CDD:275378 1/21 (5%)
leucine-rich repeat 98..121 CDD:275380 5/22 (23%)
leucine-rich repeat 122..145 CDD:275380 12/22 (55%)
leucine-rich repeat 146..169 CDD:275380 12/23 (52%)
leucine-rich repeat 170..193 CDD:275380 2/9 (22%)
leucine-rich repeat 194..217 CDD:275380
leucine-rich repeat 218..265 CDD:275380
leucine-rich repeat 266..289 CDD:275380
leucine-rich repeat 290..313 CDD:275380
leucine-rich repeat 314..338 CDD:275380
LRR_8 337..397 CDD:404697
leucine-rich repeat 339..360 CDD:275380
Lrrc3bNP_001386424.1 LRRNT 33..68 CDD:214470 12/58 (21%)
leucine-rich repeat 66..89 CDD:275378 6/45 (13%)
LRR_8 69..125 CDD:404697 23/55 (42%)
leucine-rich repeat 90..113 CDD:275378 12/22 (55%)
leucine-rich repeat 115..138 CDD:275378 12/22 (55%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.