DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Cpn2

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001100555.1 Gene:Cpn2 / 303861 RGDID:1305170 Length:565 Species:Rattus norvegicus

Alignment Length:534 Identity:135/535 (25%)
Similarity:209/535 (39%) Gaps:121/535 (23%)


  Fly    16 WLCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINL 80
            |||.|    .||||..|..|      ||..|.|.    :.:..|.|..|..:|:.:...      
  Rat    29 WLCWA----SLLLLVRVTQP------CPVGCDCF----DRKIFCSDEQLAAIPLDIPSH------ 73

  Fly    81 TVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTN 145
             |..|..:|.|                ..|:|::.|.....|..:......|..|...||.||..
  Rat    74 -VTDIVFVETS----------------FTTVGTRAFSGSPNLTKVVFLNTRVHHLEPDAFGGLPR 121

  Fly   146 LLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPAS 210
            |..|:::.:....:.....|:|:||.:|.|..|.:.:|.::.|..|:|||.|..:.|:|..:|..
  Rat   122 LEDLEVTGSPFSNLSANIFSNLSSLGKLTLDFNRLAALPEDLFHHMDTLESLQLQGNQLQTLPGR 186

  Fly   211 NLWHLHALKSLDMSLNLVEFVRNDSFEGLK--ELLALS----------------------VQGNV 251
            ....|..|::|:::.||:..:....|:.|.  ::|.||                      :..|.
  Rat   187 LFQSLRYLRTLNLAQNLLTQLPKGMFQSLSSLQILKLSDNMFARLPEGVLSNLGSLQELFLDSNA 251

  Fly   252 MSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRE 316
            ::||....|..|:||:.|.|..|.::.:|....|.|.|||:|||..|....|||..|.:...|..
  Rat   252 ITELSPHLFSHLLSLEKLWLQHNAISHLPVSAFSSLRNLTFLNLKDNALRTLPAGLFTHNPGLLH 316

  Fly   317 LHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQ 381
            |.|| .:.|:.:...:|.:...|.:|.|::| .::.:|..:|:....::::.:.||:|..|:...
  Rat   317 LSLS-YNQLETVPEGSFANLRKLASLTLSHN-AITHLPENVFRNLEQLVKLSLDSNNLTVLHPTL 379

  Fly   382 FPVDQLQKLYLGD---------------------------NPLQCNCSLLWL--W-RLVTG---N 413
            |  ..|.||.|.|                           ||.||:|.|.:|  | ||...   |
  Rat   380 F--HNLSKLQLLDLSRNQLTMLPGGIFDTNYDLFNLALLGNPWQCDCRLSYLTSWLRLYNDRIFN 442

  Fly   414 FEGVDPGMEHAAGGAVAALAKE------------ADDEE------LADEATA-----VASTDDGV 455
            ......|..:..|..|..|.:|            .||.|      ||.|..|     :....:|.
  Rat   443 THTFCAGPAYLKGQLVPNLKQEQLVCPGNPGQLGLDDREPAGSWDLAVEGRAAHRQCIYGNPEGT 507

  Fly   456 AALAAYIAEQHIVN 469
            ..||...|:...:|
  Rat   508 VLLACEEAQCRWLN 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 4/22 (18%)
LRR_RI 79..327 CDD:238064 72/272 (26%)
leucine-rich repeat 98..121 CDD:275380 3/23 (13%)
LRR_8 120..180 CDD:290566 16/60 (27%)
leucine-rich repeat 122..145 CDD:275380 7/23 (30%)
leucine-rich repeat 146..169 CDD:275380 4/23 (17%)
LRR_8 169..228 CDD:290566 20/59 (34%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
leucine-rich repeat 194..217 CDD:275380 7/23 (30%)
LRR_8 218..276 CDD:290566 19/82 (23%)
leucine-rich repeat 218..265 CDD:275380 14/71 (20%)
LRR_RI <265..406 CDD:238064 47/168 (28%)
LRR_8 265..321 CDD:290566 23/56 (41%)
leucine-rich repeat 266..289 CDD:275380 7/23 (30%)
leucine-rich repeat 290..313 CDD:275380 10/23 (43%)
leucine-rich repeat 314..338 CDD:275380 6/24 (25%)
LRR_8 337..397 CDD:290566 18/87 (21%)
leucine-rich repeat 339..360 CDD:275380 6/21 (29%)
Cpn2NP_001100555.1 LRRNT 44..75 CDD:214470 10/48 (21%)
leucine-rich repeat 77..97 CDD:275380 6/36 (17%)
LRR_8 96..156 CDD:290566 16/60 (27%)
leucine-rich repeat 122..145 CDD:275380 4/23 (17%)
leucine-rich repeat 146..169 CDD:275380 7/23 (30%)
LRR_8 169..226 CDD:290566 17/57 (30%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
LRR_RI 172..418 CDD:238064 60/250 (24%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
leucine-rich repeat 218..241 CDD:275380 3/23 (13%)
LRR_8 241..300 CDD:290566 20/59 (34%)
leucine-rich repeat 242..265 CDD:275380 5/23 (22%)
leucine-rich repeat 266..289 CDD:275380 7/23 (30%)
LRR_8 288..348 CDD:290566 21/62 (34%)
leucine-rich repeat 290..313 CDD:275380 10/23 (43%)
leucine-rich repeat 314..337 CDD:275380 6/24 (25%)
LRR_8 336..396 CDD:290566 16/63 (25%)
leucine-rich repeat 338..361 CDD:275380 6/24 (25%)
leucine-rich repeat 362..383 CDD:275380 5/23 (22%)
leucine-rich repeat 386..405 CDD:275380 3/19 (16%)
LRRCT 418..459 CDD:214507 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D187891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.