DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrc66

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_008768360.1 Gene:Lrrc66 / 289587 RGDID:1306094 Length:866 Species:Rattus norvegicus

Alignment Length:281 Identity:70/282 (25%)
Similarity:110/282 (39%) Gaps:72/282 (26%)


  Fly   149 LDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNC-----------------FKGMN-TLE 195
            ||.:.:|:..|..:.|:.|.:|..|:|.::.|.||   |                 |:|.: .|:
  Rat    79 LDRTNHRLSKVTLSCLAHLRALEMLNLGDDVIHSL---CLDLSLPSSSRQKRHRSRFRGRHPRLK 140

  Fly   196 VLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAF 260
            ||:.:.|:|...| ..||.|..|.|||:|.|....:....|.|..:|.::.::.|.:..:...||
  Rat   141 VLLLQRNQLGPTP-KGLWKLKPLCSLDLSFNRRVGIGLSGFHGCLQLKSIYLKNNKILTIHPEAF 204

  Fly   261 EGLISLKH-LDLSDNNLTMV----------PTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHL 314
            :||..|:. :||..:.|||:          |..:|....|....|.....|..:.:|::..::..
  Rat   205 KGLKKLQQVVDLRSSALTMLVPIVTIALEWPNLELGLADNQWQCNESDANFQNIASVSWGEIWKA 269

  Fly   315 ---------------------RELHLSR---LDFLQRIDS-----RAFVDNTHLQTLHLNNNPQL 350
                                 |::||.|   .|....|.|     ||.:| .||..|........
  Rat   270 VCNTPVENEKPYVEASQIRISRDIHLPRSPSSDLQSLIQSKAEKPRAGMD-VHLSALEKKAQVGY 333

  Fly   351 SDI-------PMRL--FQGNP 362
            .|:       ||.|  .||.|
  Rat   334 GDLKGIWLQSPMELRDSQGGP 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378
LRR_RI 79..327 CDD:238064 55/231 (24%)
leucine-rich repeat 98..121 CDD:275380
LRR_8 120..180 CDD:290566 9/31 (29%)
leucine-rich repeat 122..145 CDD:275380
leucine-rich repeat 146..169 CDD:275380 6/20 (30%)
LRR_8 169..228 CDD:290566 24/77 (31%)
leucine-rich repeat 170..193 CDD:275380 9/41 (22%)
leucine-rich repeat 194..217 CDD:275380 9/23 (39%)
LRR_8 218..276 CDD:290566 17/59 (29%)
leucine-rich repeat 218..265 CDD:275380 14/47 (30%)
LRR_RI <265..406 CDD:238064 32/148 (22%)
LRR_8 265..321 CDD:290566 15/88 (17%)
leucine-rich repeat 266..289 CDD:275380 8/34 (24%)
leucine-rich repeat 290..313 CDD:275380 3/23 (13%)
leucine-rich repeat 314..338 CDD:275380 10/53 (19%)
LRR_8 337..397 CDD:290566 10/36 (28%)
leucine-rich repeat 339..360 CDD:275380 7/30 (23%)
Lrrc66XP_008768360.1 leucine-rich repeat 78..99 CDD:275380 6/20 (30%)
LRR_8 137..196 CDD:290566 19/60 (32%)
leucine-rich repeat 139..161 CDD:275380 9/23 (39%)
leucine-rich repeat 162..185 CDD:275380 8/23 (35%)
LRR_8 185..245 CDD:290566 15/60 (25%)
leucine-rich repeat 186..209 CDD:275380 6/23 (26%)
leucine-rich repeat 210..236 CDD:275380 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.