DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and FLRT1

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_037412.2 Gene:FLRT1 / 23769 HGNCID:3760 Length:674 Species:Homo sapiens

Alignment Length:446 Identity:120/447 (27%)
Similarity:182/447 (41%) Gaps:109/447 (24%)


  Fly     8 TATTRSRPW--LCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQ 70
            |||...|.|  ||..    |:..||.||  ..||  |||.|:|    .|....|.|..|..:|..
Human    26 TATMDLRDWLFLCYG----LIAFLTEVI--DSTT--CPSVCRC----DNGFIYCNDRGLTSIPAD 78

  Fly    71 LNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELR--TLNLSRNLVS 133
            :..:...:.|..|:|...  .:|..:|.::   :..:|       :.|:::|.  .:||.|:| .
Human    79 IPDDATTLYLQNNQINNA--GIPQDLKTKV---NVQVI-------YLYENDLDEFPINLPRSL-R 130

  Fly   134 SLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNI--VSLEDNCFKGMNTLEV 196
            .||              |..|.:.|:...:|:.:..|.:|.|.:|::  ||:|::.|.....|::
Human   131 ELH--------------LQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKL 181

  Fly   197 LVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFE 261
            |....|.|..:| |.|.|.                       |:|   |.:..|.:|.:.|.||:
Human   182 LFLSRNHLSSIP-SGLPHT-----------------------LEE---LRLDDNRISTIPLHAFK 219

  Fly   262 GLISLKHLDLSDNNLT--MVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDF 324
            ||.||:.|.|..|.|.  .:.....|:|.|||.|:|..|..:..|    |||             
Human   220 GLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPP----LNL------------- 267

  Fly   325 LQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQF-PVDQLQ 388
                      .:.|||.|:|.:| .:|.||.........:..:.:.:|:|.||....| .:..|.
Human   268 ----------PSAHLQKLYLQDN-AISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLA 321

  Fly   389 KLYLGDNPLQCNCSLLWL--W---RLVTGNFEG-VDPGMEHAAGGAVAALAKEADD 438
            :|.|.:||..|.|:|:||  |   |....|..| :..|.|...|.|:..:..|.|:
Human   322 QLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDE 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 4/22 (18%)
LRR_RI 79..327 CDD:238064 62/254 (24%)
leucine-rich repeat 98..121 CDD:275380 2/23 (9%)
LRR_8 120..180 CDD:290566 15/62 (24%)
leucine-rich repeat 122..145 CDD:275380 7/25 (28%)
leucine-rich repeat 146..169 CDD:275380 4/23 (17%)
LRR_8 169..228 CDD:290566 16/61 (26%)
leucine-rich repeat 170..193 CDD:275380 8/25 (32%)
leucine-rich repeat 194..217 CDD:275380 8/23 (35%)
LRR_8 218..276 CDD:290566 15/58 (26%)
leucine-rich repeat 218..265 CDD:275380 10/47 (21%)
LRR_RI <265..406 CDD:238064 41/144 (28%)
LRR_8 265..321 CDD:290566 18/58 (31%)
leucine-rich repeat 266..289 CDD:275380 7/25 (28%)
leucine-rich repeat 290..313 CDD:275380 9/23 (39%)
leucine-rich repeat 314..338 CDD:275380 0/24 (0%)
LRR_8 337..397 CDD:290566 19/61 (31%)
leucine-rich repeat 339..360 CDD:275380 8/21 (38%)
FLRT1NP_037412.2 NEL <58..>329 CDD:330839 87/357 (24%)
leucine-rich repeat 108..128 CDD:275380 6/27 (22%)
leucine-rich repeat 129..152 CDD:275380 7/38 (18%)
leucine-rich repeat 153..178 CDD:275380 8/25 (32%)
leucine-rich repeat 179..199 CDD:275380 8/21 (38%)
leucine-rich repeat 200..223 CDD:275380 10/26 (38%)
leucine-rich repeat 224..249 CDD:275380 7/25 (28%)
leucine-rich repeat 250..271 CDD:275380 9/48 (19%)
leucine-rich repeat 272..295 CDD:275380 8/24 (33%)
leucine-rich repeat 296..319 CDD:275380 5/23 (22%)
PCC 300..>406 CDD:188093 25/79 (32%)
FN3 441..505 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.