DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and FLRT3

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_037413.1 Gene:FLRT3 / 23767 HGNCID:3762 Length:649 Species:Homo sapiens

Alignment Length:532 Identity:125/533 (23%)
Similarity:199/533 (37%) Gaps:122/533 (23%)


  Fly    29 LTLVILPPETTA-FCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRT--LEF 90
            |.|.:.|....| .|||.|:|..|    ...|.|..|..:|..:..:...:.|..|:|..  :..
Human    17 LFLQVAPLSVMAKSCPSVCRCDAG----FIYCNDRFLTSIPTGIPEDATTLYLQNNQINNAGIPS 77

  Fly    91 SLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNR 155
            .|...:|:|.:.|..|.::       |:.:.|      ...|..||              |..|.
Human    78 DLKNLLKVERIYLYHNSLD-------EFPTNL------PKYVKELH--------------LQENN 115

  Fly   156 IETVHPTALSDLASLVELDLTNNNI--VSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHL-HA 217
            |.|:...:||.:..|.||.|.:|::  ||:|:..|:..|.|.:|....|.|..:|    |.| ..
Human   116 IRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIP----WGLPRT 176

  Fly   218 LKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDL--SAFEGLISLKHLDLSDNNLTMVP 280
            ::.|.:..|.:..:.:.|.:||..|..|.:.||:::...|  ..|..|::|..|.|..|:||..|
Human   177 IEELRLDDNRISTISSPSLQGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAP 241

  Fly   281 TQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLN 345
            .....  :||..|.|..|..:::|..||   .:||:|:  |||.                   .|
Human   242 VNLPG--TNLRKLYLQDNHINRVPPNAF---SYLRQLY--RLDM-------------------SN 280

  Fly   346 NNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWL--WR 408
            ||  ||::|..:|.                       .:|.:.:|.|.:||..|.|.:.|:  |.
Human   281 NN--LSNLPQGIFD-----------------------DLDNITQLILRNNPWYCGCKMKWVRDWL 320

  Fly   409 L---VTGNFEG-VDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVN 469
            .   |..|..| :....|...|.|:..|..|..|           ..|.|:.:.......  |.|
Human   321 QSLPVKVNVRGLMCQAPEKVRGMAIKDLNAELFD-----------CKDSGIVSTIQITTA--IPN 372

  Fly   470 ALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPA-HIVTVV 533
            .::..:.......|...:..:..|..|.|..|        ...||.:|::...:|... ||...:
Human   373 TVYPAQGQWPAPVTKQPDIKNPKLTKDHQTTG--------SPSRKTITITVKSVTSDTIHISWKL 429

  Fly   534 CAVITCLLVAMI 545
            ...:|.|.::.:
Human   430 ALPMTALRLSWL 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 4/24 (17%)
LRR_RI 79..327 CDD:238064 69/255 (27%)
leucine-rich repeat 98..121 CDD:275380 4/23 (17%)
LRR_8 120..180 CDD:290566 15/60 (25%)
leucine-rich repeat 122..145 CDD:275380 4/23 (17%)
leucine-rich repeat 146..169 CDD:275380 6/23 (26%)
LRR_8 169..228 CDD:290566 19/62 (31%)
leucine-rich repeat 170..193 CDD:275380 10/25 (40%)
leucine-rich repeat 194..217 CDD:275380 7/24 (29%)
LRR_8 218..276 CDD:290566 16/60 (27%)
leucine-rich repeat 218..265 CDD:275380 12/49 (24%)
LRR_RI <265..406 CDD:238064 36/141 (26%)
LRR_8 265..321 CDD:290566 18/56 (32%)
leucine-rich repeat 266..289 CDD:275380 7/23 (30%)
leucine-rich repeat 290..313 CDD:275380 7/23 (30%)
leucine-rich repeat 314..338 CDD:275380 6/24 (25%)
LRR_8 337..397 CDD:290566 12/60 (20%)
leucine-rich repeat 339..360 CDD:275380 7/21 (33%)
FLRT3NP_037413.1 LRRNT 31..61 CDD:214470 10/34 (29%)
Interaction with ADGRL3. {ECO:0000269|PubMed:26235030} 38..67 6/33 (18%)
LRR 1. {ECO:0000255} 59..80 4/21 (19%)
leucine-rich repeat 61..84 CDD:275378 4/23 (17%)
LRR 2. {ECO:0000255} 84..104 6/33 (18%)
leucine-rich repeat 85..104 CDD:275380 5/32 (16%)
LRR 3. {ECO:0000255} 105..126 9/35 (26%)
LRR_8 106..166 CDD:290566 22/74 (30%)
leucine-rich repeat 106..129 CDD:275380 9/37 (24%)
LRR_RI <120..259 CDD:238064 43/145 (30%)
LRR 4. {ECO:0000255} 129..150 8/21 (38%)
leucine-rich repeat 130..155 CDD:275380 10/25 (40%)
LRR 5. {ECO:0000255} 155..175 7/24 (29%)
leucine-rich repeat 156..176 CDD:275380 7/24 (29%)
LRR_8 175..237 CDD:290566 16/62 (26%)
LRR 6. {ECO:0000255} 176..197 3/21 (14%)
leucine-rich repeat 177..200 CDD:275380 5/23 (22%)
LRR 7. {ECO:0000255} 200..220 5/20 (25%)
leucine-rich repeat 201..226 CDD:275380 7/25 (28%)
LRR 8. {ECO:0000255} 226..247 7/23 (30%)
leucine-rich repeat 227..248 CDD:275380 7/23 (30%)
LRR_8 247..306 CDD:290566 25/108 (23%)
LRR_4 247..287 CDD:289563 19/66 (29%)
LRR 9. {ECO:0000255} 248..269 8/24 (33%)
leucine-rich repeat 249..272 CDD:275380 9/26 (35%)
LRR 10. {ECO:0000255} 272..293 11/67 (16%)
leucine-rich repeat 273..296 CDD:275380 12/69 (17%)
LRRCT 305..356 CDD:214507 15/62 (24%)
fn3 413..478 CDD:278470 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.