DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrtm3

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_848793.1 Gene:Lrrtm3 / 216028 MGIID:2389177 Length:582 Species:Mus musculus


Alignment Length:403 Identity:93/403 - (23%)
Similarity:162/403 - (40%) Gaps:96/403 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86
            |.:||.:|:      .....||..|:|.|    ....|....|:::|..::.....::|..|.::
Mouse    20 PTVLLTMLS------SAERGCPKGCRCEG----KMVYCESQKLQEIPSSISAGCLGLSLRYNSLQ 74

  Fly    87 TLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDL 151
            .|:::                       .|:..::|..|.|..|.:|::.::||.|:..|..|.|
Mouse    75 KLKYN-----------------------QFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELIL 116

  Fly   152 SFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLH 216
            |.|||..........:.:|..|||:.|.:.||....|:|:..|..|..|:|.|..:|........
Mouse   117 SSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCR 181

  Fly   217 ALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPT 281
            .|:.||:..|.:..:..:.|.|:..|..|.::.|..|:|:|:.|..|:||::|.:..|.::::..
Mouse   182 NLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQ 246

  Fly   282 QQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNN 346
            ......|:|..|:|.||                              :..||            :
Mouse   247 TMSWTWSSLQRLDLSGN------------------------------EIEAF------------S 269

  Fly   347 NPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVD---QLQKLYLGDNPLQCN---CSLL- 404
            .|.       :||..||:..:.:.||.|  .:..|..:|   .|..:.|..|..:|:   |||: 
Mouse   270 GPS-------VFQCVPNLQRLNLDSNKL--TFIGQEILDSWISLNDISLAGNIWECSRNICSLVN 325

  Fly   405 WLWRLVTGNFEGV 417
            ||     .:|:|:
Mouse   326 WL-----RSFKGL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 LRR 71..>348 CDD:443914 60/276 (22%)
leucine-rich repeat 75..97 CDD:275378 3/21 (14%)
leucine-rich repeat 98..121 CDD:275380 1/22 (5%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
leucine-rich repeat 170..193 CDD:275380 9/22 (41%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 14/46 (30%)
leucine-rich repeat 266..289 CDD:275380 3/22 (14%)
leucine-rich repeat 290..313 CDD:275380 5/22 (23%)
leucine-rich repeat 314..338 CDD:275380 2/23 (9%)
LRR_8 337..397 CDD:404697 13/62 (21%)
leucine-rich repeat 339..360 CDD:275380 2/20 (10%)
Lrrtm3NP_848793.1 LRRNT 33..61 CDD:214470 8/31 (26%)
LRR 59..339 CDD:443914 81/354 (23%)
LRR 1 63..83 4/42 (10%)
leucine-rich repeat 66..86 CDD:275380 4/42 (10%)
LRR 2 86..107 7/20 (35%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
LRR 3 110..131 7/20 (35%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
LRR 4 134..155 8/20 (40%)
leucine-rich repeat 135..158 CDD:275380 9/22 (41%)
LRR 5 158..179 6/20 (30%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR 6 182..203 5/20 (25%)
leucine-rich repeat 183..206 CDD:275380 6/22 (27%)
LRR 7 206..226 6/19 (32%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR 8 230..251 4/20 (20%)
leucine-rich repeat 231..254 CDD:275380 3/22 (14%)
LRR 9 254..275 8/69 (12%)
leucine-rich repeat 255..279 CDD:275380 10/72 (14%)
LRR 10 279..300 5/22 (23%)
leucine-rich repeat 280..300 CDD:275380 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.