DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Lrrtm3

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_848793.1 Gene:Lrrtm3 / 216028 MGIID:2389177 Length:582 Species:Mus musculus

Alignment Length:403 Identity:93/404 (23%)
Similarity:162/404 (40%) Gaps:96/404 (24%)


  Fly    22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIR 86
            |.:||.:|:      .....||..|:|.|    ....|....|:::|..::.....::|..|.::
Mouse    20 PTVLLTMLS------SAERGCPKGCRCEG----KMVYCESQKLQEIPSSISAGCLGLSLRYNSLQ 74

  Fly    87 TLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDL 151
            .|:::                       .|:..::|..|.|..|.:|::.::||.|:..|..|.|
Mouse    75 KLKYN-----------------------QFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELIL 116

  Fly   152 SFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLH 216
            |.|||..........:.:|..|||:.|.:.||....|:|:..|..|..|:|.|..:|........
Mouse   117 SSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDCR 181

  Fly   217 ALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPT 281
            .|:.||:..|.:..:..:.|.|:..|..|.::.|..|:|:|:.|..|:||::|.:..|.::::..
Mouse   182 NLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYMQWNKISVIGQ 246

  Fly   282 QQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNN 346
            ......|:|..|:|.||                              :..||            :
Mouse   247 TMSWTWSSLQRLDLSGN------------------------------EIEAF------------S 269

  Fly   347 NPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVD---QLQKLYLGDNPLQCN---CSLL- 404
            .|.       :||..||:..:.:.||.|  .:..|..:|   .|..:.|..|..:|:   |||: 
Mouse   270 GPS-------VFQCVPNLQRLNLDSNKL--TFIGQEILDSWISLNDISLAGNIWECSRNICSLVN 325

  Fly   405 WLWRLVTGNFEGV 417
            ||     .:|:|:
Mouse   326 WL-----RSFKGL 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 3/22 (14%)
LRR_RI 79..327 CDD:238064 58/248 (23%)
leucine-rich repeat 98..121 CDD:275380 1/23 (4%)
LRR_8 120..180 CDD:290566 20/60 (33%)
leucine-rich repeat 122..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..169 CDD:275380 7/23 (30%)
LRR_8 169..228 CDD:290566 19/59 (32%)
leucine-rich repeat 170..193 CDD:275380 9/23 (39%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
LRR_8 218..276 CDD:290566 18/58 (31%)
leucine-rich repeat 218..265 CDD:275380 14/47 (30%)
LRR_RI <265..406 CDD:238064 30/148 (20%)
LRR_8 265..321 CDD:290566 10/56 (18%)
leucine-rich repeat 266..289 CDD:275380 4/23 (17%)
leucine-rich repeat 290..313 CDD:275380 5/23 (22%)
leucine-rich repeat 314..338 CDD:275380 2/24 (8%)
LRR_8 337..397 CDD:290566 13/63 (21%)
leucine-rich repeat 339..360 CDD:275380 3/21 (14%)
Lrrtm3NP_848793.1 LRRNT 33..61 CDD:214470 8/32 (25%)
LRR 1 63..83 4/43 (9%)
leucine-rich repeat 66..86 CDD:275380 4/43 (9%)
LRR_RI <81..300 CDD:238064 67/270 (25%)
LRR_8 86..145 CDD:290566 20/59 (34%)
LRR 2 86..107 7/21 (33%)
leucine-rich repeat 87..110 CDD:275380 8/23 (35%)
LRR 3 110..131 7/21 (33%)
leucine-rich repeat 111..134 CDD:275380 7/23 (30%)
LRR_8 133..193 CDD:290566 19/60 (32%)
LRR 4 134..155 8/21 (38%)
leucine-rich repeat 135..158 CDD:275380 9/23 (39%)
LRR 5 158..179 6/21 (29%)
leucine-rich repeat 159..182 CDD:275380 6/23 (26%)
LRR_8 181..241 CDD:290566 18/60 (30%)
LRR 6 182..203 5/21 (24%)
leucine-rich repeat 183..206 CDD:275380 6/23 (26%)
LRR 7 206..226 7/20 (35%)
leucine-rich repeat 207..230 CDD:275380 8/23 (35%)
LRR_8 230..290 CDD:290566 19/109 (17%)
LRR 8 230..251 4/21 (19%)
leucine-rich repeat 231..254 CDD:275380 4/23 (17%)
LRR 9 254..275 9/70 (13%)
leucine-rich repeat 255..279 CDD:275380 11/73 (15%)
LRR 10 279..300 6/23 (26%)
leucine-rich repeat 280..300 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.