DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Chadl

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:XP_017172033.1 Gene:Chadl / 214685 MGIID:3036284 Length:794 Species:Mus musculus

Alignment Length:724 Identity:179/725 (25%)
Similarity:258/725 (36%) Gaps:182/725 (25%)


  Fly    20 AIPV----------LLLLLLTLVILPPETTAF------CPSKCQCLGGEANSR--ALCVDAALED 66
            |:||          :.:|||.:|:|  ::.|:      ||..|.|    .|||  ..|....|.:
Mouse    42 AVPVGMERPQSSIWVFMLLLFMVLL--QSPAWHVAAQRCPQTCVC----DNSRRHVTCRHQNLTE 100

  Fly    67 VPIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNL 131
            ||..: ||     ||                 :.|||..||::.|.:..|:....|..|:|....
Mouse   101 VPNTI-PE-----LT-----------------QRLDLQGNILKVLPAAAFQDLPHLTHLDLRNCQ 142

  Fly   132 VSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEV 196
            |..:.:.||:||..||||:|:.||:.|:...||..|.||..|:|..|.:..|....|..:.:|..
Mouse   143 VEMVAEGAFRGLGRLLLLNLASNRLSTLPQEALDGLGSLRRLELEGNMLEELRPGTFGALGSLTT 207

  Fly   197 LVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFE 261
            |...:|.|:.:||.                        :|:||.....|.:..|.:|.|...|..
Mouse   208 LNLAHNALVYLPAM------------------------AFQGLLRTRWLQLSHNALSVLAPEALA 248

  Fly   262 GLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQ 326
            ||.:|:.|.|..|.|..:|...||:..:|..|.||.|..:.......|.|..||||.|.. ..||
Mouse   249 GLPALRRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLRELALDH-GSLQ 312

  Fly   327 RIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLY 391
            .:..|||.....|.||.|                         :.|.|.||...|.| .||::|.
Mouse   313 ALGPRAFAHCPRLHTLDL-------------------------RGNQLTTLPPLQVP-GQLRRLR 351

  Fly   392 LGDNPLQCNCS----LLWLWRLVTGNFEGVDPGMEHAAGGAVAALAKEADDEELADEATAVASTD 452
            |..|||.|.|.    |.||.|....: :|...|.....|.|:..|.    ..:|.....|.|...
Mouse   352 LQGNPLWCACHARPLLEWLVRARVRS-DGACRGPRRLRGEALDTLR----PSDLRCPGDAAAGDG 411

  Fly   453 DG-------VAALAAYIAEQHIVNALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVR 510
            ||       ....|..:...|...|..|..|.|  .|..:..|:|.......|.:......|   
Mouse   412 DGDEDEDRPAGPRAPPLRSPHGEAAWATPCPPA--CACVAETRHSTCDGRGLQAVPRGFPND--- 471

  Fly   511 TRRKLLTMSEGEI-TCP-------AHIVTV---VCAVITCLLVAMIGISVLYYL----------- 553
              .:||.:..... :.|       .|:|::   .|.|......|:.|:..|.||           
Mouse   472 --TQLLDLRRNHFPSVPRAAFPGLRHLVSLHLQHCGVAELEPGALAGLDRLLYLYLSHNQLSGLS 534

  Fly   554 ------------RFVKRRRKLLHERGPMRTSKSIINVH------DRILQGHNPGGLGLGMSMTLG 600
                        .:::..|.|......:|...:::::|      ||:..|...|...|.....  
Mouse   535 AAALEGAPNLGYLYLEHNRFLRIPGTALRALPTLVSLHLQDNAVDRLAPGDLAGARALRCLYL-- 597

  Fly   601 GGNHVNGLGM-TLNYPHHAQTLQAHHHYHQAMPLQSHGGNGNHEYQQTTLPQLDKLELERYLAAQ 664
            .|||:..:.. .|......:.|....:..:.:|..:..|          ||.|.:|:|.      
Mouse   598 SGNHITQVSPGALGPARELEKLHLDRNRLREVPTGALEG----------LPALKELQLS------ 646

  Fly   665 TIANEYRAL 673
              .|..|||
Mouse   647 --GNPLRAL 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 2/22 (9%)
LRR_RI 79..327 CDD:238064 73/248 (29%)
leucine-rich repeat 98..121 CDD:275380 7/23 (30%)
LRR_8 120..180 CDD:290566 24/60 (40%)
leucine-rich repeat 122..145 CDD:275380 8/23 (35%)
leucine-rich repeat 146..169 CDD:275380 11/23 (48%)
LRR_8 169..228 CDD:290566 13/59 (22%)
leucine-rich repeat 170..193 CDD:275380 6/23 (26%)
leucine-rich repeat 194..217 CDD:275380 6/23 (26%)
LRR_8 218..276 CDD:290566 14/58 (24%)
leucine-rich repeat 218..265 CDD:275380 10/47 (21%)
LRR_RI <265..406 CDD:238064 46/145 (32%)
LRR_8 265..321 CDD:290566 20/56 (36%)
leucine-rich repeat 266..289 CDD:275380 8/23 (35%)
leucine-rich repeat 290..313 CDD:275380 7/23 (30%)
leucine-rich repeat 314..338 CDD:275380 10/24 (42%)
LRR_8 337..397 CDD:290566 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 4/21 (19%)
ChadlXP_017172033.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.