DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and lron-1

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_510424.4 Gene:lron-1 / 181553 WormBaseID:WBGene00008093 Length:607 Species:Caenorhabditis elegans

Alignment Length:680 Identity:144/681 (21%)
Similarity:259/681 (38%) Gaps:166/681 (24%)


  Fly    16 WLCGAIPVLLLLLLTLVILPPET---TAFCPSKCQCLGGEANSRALCVDAALE------------ 65
            |:....|       ||.:..|.|   |.:......|.||.:      :||.||            
 Worm    13 WVYSQCP-------TLQLQEPCTCTSTRYEAVSINCDGGSS------LDAVLESLSNSPQAIDSL 64

  Fly    66 ---DVPIQLNP-------ETKYINLTVNRIRTLE---FSLPFYMKLEILDLSQNIIETLGSKNFE 117
               :.||:..|       :.|.:.|..|.:|:..   |:......||.|::..|.|:.:......
 Worm    65 TISNTPIEKMPGYAFQGFQIKKLFLRNNGLRSFHPNTFTGNLENSLEELEIRGNYIDGIPQSGVS 129

  Fly   118 YQSELRTLNLSRNLVSSLHKHAF---KGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNN 179
            ...:|:.|:|..||:..:..:||   ....:||.||||.|.:..:|||.|..|.:|.:|.|..|.
 Worm   130 ILKQLKILSLPDNLIEYVQDNAFLSYHSRDSLLKLDLSANNLTAIHPTGLLGLENLSQLSLDKNL 194

  Fly   180 IVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLA 244
            :..:.....:.:.:||.|....||:..:..::| .|..||||.:.:|.:..:.:|||.....|..
 Worm   195 LSEIPSQALENIPSLEDLSLGVNRIHTISRNSL-PLPNLKSLSLEVNQIRLIPSDSFSETPLLSY 258

  Fly   245 LSVQGNVMSELDLS----------------------------------------AFEGLISLKHL 269
            |.:..|:::.:|.|                                        ||:...||..|
 Worm   259 LYLGNNLLTSIDASMFLHIGGLKVLSMSNNKDITSIQANGKLSVQQFKLCICILAFQHAPSLIRL 323

  Fly   270 DLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFV 334
            :|.|.:::.:..:.|.|:.::..:.|..|:.:::....|.||..|.||.||. :.:..:|..||.
 Worm   324 ELFDCSISRIEPKSLQKVQHIQVILLSRNQITRISHDTFSNLPELSELDLSG-NSINAVDDFAFS 387

  Fly   335 DNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQC 399
            ....|.:|.|::| :|..:|..:      |.:..||..:        .||.  :||.:.:||.:|
 Worm   388 QLPMLTSLDLSSN-RLESLPSNV------IYDSLMQKKT--------SPVQ--RKLSIQNNPWRC 435

  Fly   400 NCSLLWLWRLVTGNFEGVDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAE 464
            :..|:||.:.:..|             |.|...|        ::...|...|...::.|.....:
 Worm   436 DKDLMWLRKWLRDN-------------GDVTTAA--------SNSPPAKCWTPSNLSGLDLRQTD 479

  Fly   465 QHIVNALHTTEP--SAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPA 527
            ..:.:  .||:|  ..::........::|..::..|....::                       
 Worm   480 SKLPH--KTTKPPVDQFQYKNQQVTNSNGTSQLGYQNPHTEV----------------------- 519

  Fly   528 HIVTVVCAVITCLLVAMIGISVL-YYLRFV----KRRRKLLHERGPMRTSKSIINVHDRILQGHN 587
            :.:.:|..::..:||..:...:| |.:||:    :.:.|.......:.:|..|.|::        
 Worm   520 NGLALVGLILGIVLVVFVSCIILGYLMRFIFLSYEAKTKPNVFGSTISSSGCIRNMY-------- 576

  Fly   588 PGGLGLGMSMTLGGGNHVNGLGMTLNYPHH 617
             ||.|..:|...|..:..|. .:.||.|.|
 Worm   577 -GGDGTLVSEDHGHPSSANN-NVYLNRPRH 604

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 5/25 (20%)
LRR_RI 79..327 CDD:238064 71/294 (24%)
leucine-rich repeat 98..121 CDD:275380 5/23 (22%)
LRR_8 120..180 CDD:290566 23/63 (37%)
leucine-rich repeat 122..145 CDD:275380 7/26 (27%)
leucine-rich repeat 146..169 CDD:275380 12/23 (52%)
LRR_8 169..228 CDD:290566 16/59 (27%)
leucine-rich repeat 170..193 CDD:275380 4/23 (17%)
leucine-rich repeat 194..217 CDD:275380 7/23 (30%)
LRR_8 218..276 CDD:290566 20/98 (20%)
leucine-rich repeat 218..265 CDD:275380 15/87 (17%)
LRR_RI <265..406 CDD:238064 38/141 (27%)
LRR_8 265..321 CDD:290566 17/56 (30%)
leucine-rich repeat 266..289 CDD:275380 6/23 (26%)
leucine-rich repeat 290..313 CDD:275380 5/23 (22%)
leucine-rich repeat 314..338 CDD:275380 8/24 (33%)
LRR_8 337..397 CDD:290566 15/60 (25%)
leucine-rich repeat 339..360 CDD:275380 6/21 (29%)
lron-1NP_510424.4 LRR_8 83..144 CDD:290566 15/61 (25%)
leucine-rich repeat 85..109 CDD:275380 5/24 (21%)
leucine-rich repeat 110..133 CDD:275380 5/23 (22%)
leucine-rich repeat 134..157 CDD:275380 7/23 (30%)
LRR_RI 156..403 CDD:238064 63/250 (25%)
LRR_8 160..219 CDD:290566 21/59 (36%)
leucine-rich repeat 161..184 CDD:275380 12/23 (52%)
leucine-rich repeat 185..208 CDD:275380 4/23 (17%)
leucine-rich repeat 209..231 CDD:275380 7/23 (30%)
LRR_8 230..289 CDD:290566 13/59 (22%)
leucine-rich repeat 232..255 CDD:275380 8/23 (35%)
leucine-rich repeat 256..279 CDD:275380 5/23 (22%)
leucine-rich repeat 280..319 CDD:275380 2/39 (5%)
leucine-rich repeat 320..343 CDD:275380 6/23 (26%)
LRR_8 343..402 CDD:290566 17/61 (28%)
leucine-rich repeat 344..367 CDD:275380 5/23 (22%)
leucine-rich repeat 368..391 CDD:275380 8/24 (33%)
leucine-rich repeat 392..410 CDD:275380 6/25 (24%)
leucine-rich repeat 414..435 CDD:275378 8/31 (26%)
LRRCT 431..>472 CDD:214507 12/62 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D187891at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.