DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and RTN4RL1

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_848663.1 Gene:RTN4RL1 / 146760 HGNCID:21329 Length:441 Species:Homo sapiens

Alignment Length:304 Identity:86/305 (28%)
Similarity:121/305 (40%) Gaps:67/305 (22%)


  Fly   134 SLHKHAFKGLTNLLLLD-----LSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNT 193
            |...|.|..:...:.:|     |..|||..:.|...|  .::|.|.:.:|||..:..:.|:|...
Human    39 SCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFS--PAMVTLWIYSNNITYIHPSTFEGFVH 101

  Fly   194 LEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLS 258
            ||.|...:||.|...|.                       ::|:||.:|.||.:....:|.|...
Human   102 LEELDLGDNRQLRTLAP-----------------------ETFQGLVKLHALYLYKCGLSALPAG 143

  Fly   259 AFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLD 323
            .|.||.||::|.|.||::..:.......|.||::|.|.||:...|....|..|.:|..|.|.. :
Human   144 VFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHE-N 207

  Fly   324 FLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQ 388
            .||.:..:||.|...|.||.|.|| .||::     ||                  ....|:..|:
Human   208 QLQWVHHKAFHDLRRLTTLFLFNN-SLSEL-----QG------------------ECLAPLGALE 248

  Fly   389 KLYLGDNPLQCNCSL--LWLWRLVTGNFEG-------VDPGMEH 423
            .|.|..||..|.|..  ||.|   ...|.|       |.||:.|
Human   249 FLRLNGNPWDCGCRARSLWEW---LQRFRGSSSAVPCVSPGLRH 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378
LRR_RI 79..327 CDD:238064 56/198 (28%)
leucine-rich repeat 98..121 CDD:275380
LRR_8 120..180 CDD:290566 14/51 (27%)
leucine-rich repeat 122..145 CDD:275380 3/11 (27%)
leucine-rich repeat 146..169 CDD:275380 7/28 (25%)
LRR_8 169..228 CDD:290566 14/59 (24%)
leucine-rich repeat 170..193 CDD:275380 7/23 (30%)
leucine-rich repeat 194..217 CDD:275380 7/23 (30%)
LRR_8 218..276 CDD:290566 17/58 (29%)
leucine-rich repeat 218..265 CDD:275380 11/47 (23%)
LRR_RI <265..406 CDD:238064 44/143 (31%)
LRR_8 265..321 CDD:290566 19/56 (34%)
leucine-rich repeat 266..289 CDD:275380 6/23 (26%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..338 CDD:275380 8/24 (33%)
LRR_8 337..397 CDD:290566 16/60 (27%)
leucine-rich repeat 339..360 CDD:275380 9/21 (43%)
RTN4RL1NP_848663.1 leucine-rich repeat 37..54 CDD:275380 3/15 (20%)
LRR 1 55..76 7/23 (30%)
LRR_8 57..111 CDD:316378 17/56 (30%)
leucine-rich repeat 57..77 CDD:275380 6/22 (27%)
LRR 2 77..98 6/21 (29%)
leucine-rich repeat 78..101 CDD:275380 7/23 (30%)
LRR 3 101..123 8/45 (18%)
leucine-rich repeat 102..126 CDD:275380 10/47 (21%)
LRR_8 126..185 CDD:316378 21/59 (36%)
LRR 4 126..147 6/21 (29%)
leucine-rich repeat 127..150 CDD:275380 8/23 (35%)
LRR 5 150..171 6/21 (29%)
leucine-rich repeat 151..174 CDD:275380 6/23 (26%)
LRR_8 174..233 CDD:316378 23/61 (38%)
LRR 6 174..195 8/21 (38%)
leucine-rich repeat 175..198 CDD:275380 8/23 (35%)
LRR 7 198..219 7/22 (32%)
leucine-rich repeat 199..222 CDD:275380 8/24 (33%)
LRR 8 222..243 10/45 (22%)
leucine-rich repeat 223..246 CDD:275380 11/47 (23%)
TPKR_C2 255..300 CDD:326558 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.