DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and chadlb

DIOPT Version :8

Sequence 1:NP_001097402.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:738 Species:Drosophila melanogaster
Sequence 2:NP_001274009.1 Gene:chadlb / 100330176 ZFINID:ZDB-GENE-121205-5 Length:765 Species:Danio rerio

Alignment Length:748 Identity:165/749 (22%)
Similarity:288/749 (38%) Gaps:209/749 (28%)


  Fly    19 GAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVN 83
            |:||...:::|..:.:....:|.||..|.|  ........||:..|.:||..::      .:||.
Zfish     2 GSIPTWPVIILFALKIHTALSAKCPKVCVC--DSIQLTIACVNKNLTEVPPTID------EITVK 58

  Fly    84 RIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLL 148
                             |||..|.::.|.:..|.:...|..|:|..:.:..:.:.||:.|..|:|
Zfish    59 -----------------LDLRGNDLQELPTGAFAHTPYLTHLSLQNSNIRRVREGAFRKLGRLVL 106

  Fly   149 LDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLW 213
            |:|:.|:||.::..:...|:||.:|.:..|.:..::...|..:..|.:|...:|:|:.:|     
Zfish   107 LNLANNKIEILYQESFDGLSSLKQLIIDRNRVEEIQPGAFSQLGFLNLLSLTHNQLVYIP----- 166

  Fly   214 HLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTM 278
                               |.:|:||:.:..|.:..|.::.|...||.||.:|..|.|.:|.|..
Zfish   167 -------------------NMAFQGLQNIKWLRLSHNFINYLATEAFAGLFTLTRLSLDNNELQF 212

  Fly   279 VPTQQLSKLSNLTYLNLGGNRFSQL--PAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQT 341
            .||:.:::||.:|.|.|..|..:.|  .:|:.|.|.||...|.|..||    .:.|.:.:..|..
Zfish   213 FPTETMTRLSEVTRLELSFNPMTYLGEESVSMLKLTHLLLDHNSLQDF----SNAAILLSPRLTH 273

  Fly   342 LHLNNNPQLSDIPMRLFQ----GNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCS 402
            |.|::|      .:|:.|    |:|                       :|.:|.|..||:.|:|.
Zfish   274 LDLSHN------QLRILQPMAPGSP-----------------------KLTRLNLAGNPIYCSCY 309

  Fly   403 L--LWLW----RLVTGNFEGVDPGMEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAY 461
            |  |..|    |:..|   |...|..|.:|          ::.|:.........:.:  |.|.|.
Zfish   310 LRPLREWATRERVRLG---GTCGGPAHLSG----------ENLEVVQPVNLRCLSQE--AMLKAE 359

  Fly   462 IAEQHIVNALHTTEPSAYE------LATSSSNR-----NSGILRMDR------------------ 497
            :.|| ::.||.|| ||..:      .|..:.||     |.|..::.|                  
Zfish   360 LEEQ-VLPALPTT-PSPKKGKCPANCACETENRHSSCENKGHTKIPRGFSPDTRLLDLRGNHFHY 422

  Fly   498 ----------QQIGCDIWRDKVRT--------RRKL--LTMSEGEITCPAHIVTVVCAVITCLLV 542
                      :.:...:.|.|:..        .:.|  |.:||.::|             :....
Zfish   423 IPANSFPGTAEVVSLHLQRCKIHDIEDGAFSGMKSLVYLYLSENDLT-------------SLTPE 474

  Fly   543 AMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRILQGHNPGGLGLGMSMTLGGGNHVNG 607
            |..|:..|.||. :::.|.....:|..:....::.:|   ::.:....|..|:   |.....:.|
Zfish   475 AFKGLPHLTYLH-LEKNRFTQFPKGAFKLLPGLLALH---MENNAIAKLETGL---LTSAEKLRG 532

  Fly   608 LGMTLNYPHHAQTLQAHHHYHQAMPLQS-HGGNGNHEYQQTTLPQLDKLELERYLAAQTIANEYR 671
            |.:|.|    |.|..|...::.|..|:: |.|:.          :|.::..|.:..|:::|.   
Zfish   533 LYLTSN----AITAAAPQAFNPAPDLETLHLGSN----------KLQEVPTEAFSKARSLAE--- 580

  Fly   672 ALKPWELPVK---EADDEP-----EHLYERFDH 696
             ||....|::   ....:|     .|||  .||
Zfish   581 -LKLSHNPIRWIGAGAFQPVGTTLRHLY--LDH 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FiliNP_001097402.1 leucine-rich repeat 75..97 CDD:275378 2/22 (9%)
LRR_RI 79..327 CDD:238064 66/250 (26%)
leucine-rich repeat 98..121 CDD:275380 6/23 (26%)
LRR_8 120..180 CDD:290566 18/60 (30%)
leucine-rich repeat 122..145 CDD:275380 6/23 (26%)
leucine-rich repeat 146..169 CDD:275380 8/23 (35%)
LRR_8 169..228 CDD:290566 10/59 (17%)
leucine-rich repeat 170..193 CDD:275380 4/23 (17%)
leucine-rich repeat 194..217 CDD:275380 5/23 (22%)
LRR_8 218..276 CDD:290566 15/58 (26%)
leucine-rich repeat 218..265 CDD:275380 11/47 (23%)
LRR_RI <265..406 CDD:238064 41/149 (28%)
LRR_8 265..321 CDD:290566 21/58 (36%)
leucine-rich repeat 266..289 CDD:275380 9/23 (39%)
leucine-rich repeat 290..313 CDD:275380 8/25 (32%)
leucine-rich repeat 314..338 CDD:275380 6/24 (25%)
LRR_8 337..397 CDD:290566 13/64 (20%)
leucine-rich repeat 339..360 CDD:275380 6/25 (24%)
chadlbNP_001274009.1 leucine-rich repeat 58..79 CDD:275380 6/38 (16%)
LRR_RI 59..307 CDD:238064 79/305 (26%)
LRR_8 78..138 CDD:290566 18/60 (30%)
leucine-rich repeat 80..103 CDD:275380 6/23 (26%)
leucine-rich repeat 104..127 CDD:275380 8/23 (35%)
LRR_8 126..184 CDD:290566 15/82 (18%)
leucine-rich repeat 128..151 CDD:275380 4/23 (17%)
leucine-rich repeat 152..175 CDD:275380 9/47 (19%)
LRR_8 175..234 CDD:290566 20/59 (34%)
leucine-rich repeat 176..199 CDD:275380 7/23 (30%)
leucine-rich repeat 200..223 CDD:275380 9/23 (39%)
leucine-rich repeat 224..246 CDD:275380 7/22 (32%)
LRR_8 246..304 CDD:290566 21/91 (23%)
leucine-rich repeat 247..270 CDD:275380 8/27 (30%)
TPKR_C2 302..342 CDD:301599 14/53 (26%)
LRR_RI 408..609 CDD:238064 40/241 (17%)
leucine-rich repeat 410..433 CDD:275380 0/23 (0%)
leucine-rich repeat 434..457 CDD:275380 2/23 (9%)
LRR_8 436..492 CDD:290566 13/70 (19%)
leucine-rich repeat 458..481 CDD:275380 7/36 (19%)
LRR_8 480..540 CDD:290566 14/71 (20%)
leucine-rich repeat 482..505 CDD:275380 5/24 (21%)
leucine-rich repeat 506..529 CDD:275380 4/29 (14%)
LRR_8 529..588 CDD:290566 18/77 (23%)
leucine-rich repeat 530..553 CDD:275380 8/27 (30%)
leucine-rich repeat 554..577 CDD:275380 6/33 (18%)
leucine-rich repeat 578..602 CDD:275380 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.